Edition Bircher-Benner

Unsere Handbücher in der Übersicht


Bircher-Benner Handbuch Nr. 1 Handbuch für Multiple-Sklerose-Kranke, Morbus Parkinson und andere neurodegenerative Leiden

Damit die Ursachen der multiplen Sklerose und anderer neurodegenerativer Krankheiten, soweit sie bis heute bekannt sind, verstanden werden können, ist es wichtig, einige Grundkenntnisse über den Bau und die Funktion des zentralen Nervensystems zu vermitteln. Die multiple Sklerose kann grundsätzlich an jedem Ort das zentrale Nervensystem angreifen und Schaden anrichten, so dass ihre Erscheinungsformen sehr vielfältig sind. Die Parkinsonsche Krankheit verläuft dagegen viel einheitlicher, da hier immer der Nukleus niger, ein pigmentierter Kern der Stammganglien des Gehirns im Zentrum der Zerstörung durch α-Synuclein steht und degeneriert, bevor die Demenz sich bemerkbar macht. Auch die amyotrophische Lateralsklerose zeigt einen typischen Verlauf, denn sie befällt fast ausschliesslich die motorischen Nervenbahnen, welche Kraft und Aktion der Muskulatur bewirken, so dass sie aufsteigende Lähmungen erzeugt. Die Vaskuläre Demenz zeigt ein unterschiedliches Bild und ist in der Regel mit Lähmungen verbunden, die dem Ort der erfolgten Gefässverschlüsse oder Einblutungen entsprechen. Die Alzheimerdemenz entsteht grundsätzlich im ganzen Gehirn, wobei aber anfangs ganz besonders der Hippocampus und das limbische System betroffen sind, welche für das Gedächtnis besonders wichtig sind. Besonders rasch und tragisch verläuft die Multisystematrophie (MSA). Auch bei ihr ergreift das degenerative Geschehen das ganze Gehirn

Erklärungen zu einigen anatomischen und funktionellen Begebenheiten des zentralen Nervensystems führen uns an die Ursachen dieser Krankheiten heran und ermöglichen dadurch jedem verständigen Patienten und seinen Angehörigen, aktiv an deren Verhütung und an der Heilung, soweit dies noch möglich ist, mitzuwirken; ein Weg, der sich lohnt.

Inhalt

  • Vorwort…7
  • Einleitung…10
  • Der Aufbau des zentralen Nervensystems…11
  • Das Grosshirn…11
  • Der Thalamuskern…12
  • Das Kleinhirn (Cerebellum)…13
  • Das limbisches System…13
  • Die Hormonbildenden Drüsen des Gehirns…14
  • Der Hypophysenvorderlappen (Adenohypophyse)…14
  • Der Hypophysenhinterlappen (Neurohypophyse)…15
  • Die Zirbeldrüse (Epiphyse) und das Melatonin…15
  • Die Nervenzelle (Neuron)…16
  • Das Aktionspotential…17
  • Die Synapsen…18
  • Botenstoffe des Nervensystems (Neurotransmitter)…18
  • Die Bedeutung der Gliazellen im Gehirn…19
  • Die Hohlräume des Gehirns und die Flüssigkeit in Gehirn und Rückenmark…21
  • Die Blut-Hirnschranke…22
  • Der Transport durch die Blut-Hirnschranke…24
  • Das Verhalten der Blut-Hirnschranke beim Stofftransport in und aus dem Gehirn…25
  • Die Wirkung des Alkoholkonsums auf die Blut-Hirnschranke…26
  • Die Wirkung des Rauchens auf die Blut-Hirnschranke…27
  • Die Wirkung elektromagnetischer Strahlung auf das menschliche Gehirn und die Blut-Hirnschranke…28
  • Die Myelin-Markscheiden, eine empfindliche Substanz…29
  • Demyelinisierende Erkrankungen…30
  • Remyelinisation…31
  • Das Guillain-Barré-Syndrom (GBS)…32
  • Krankheiten durch die Einlagerung von degenerativen Eiweissen…33
  • Die TAU-Proteine…33
  • Die Amyloidose…34
  • Die Wirkung der Ernährung auf das zentrale Nervensystem…35
  • Zweierlei Nahrungsenergie…35
  • Das Grundregulationssystem des zarten Bindegewebes im zentralen
  • Nervensystem… 37
  • Oxydativer Stress im Zentrum der Ursachen der neurodegenerativen Krankheiten.39
  • Der Einfluss der Umweltbelastung durch Schadstoffen als Ursache für die neurogenerativen Krankheiten…41
  • Die neurotoxische Wirkung des Quecksilbers…41
  • Organische Zinnverbindungen und Neurodegeneration…42
  • Chlor und neurodegenerative Krankheiten…43
  • Die neurotoxische Wirkung flüchtiger organischer Kohlenwasserstoffe…44
  • Insektizide und neurodegenerative Krankheiten…44
  • Holzschutzmittel und neurodegenerative Krankheiten…46
  • Neurotoxische Medikamente und Neurodegeneration…46
  • Legale und verbotene Drogen und neurodegenerative Krankheiten…47
  • Cannabis…47
  • Amphetamine …47
  • LSD (Lysergsäure-Diethylamid)…48
  • Heroin, Morphium, andere Opiate…48
  • Nikotin…48
  • Alkohol…49
  • Coffein…50
  • Zum Phänomen der Primär- und Sekundärwirkungen und der Gefahr medikamentöser Polypragmasie…52
  • Die Kombinationswirkung neurotoxischer Schadstoffe…52
  • Vitamine, Spurenelemente und neurodegenerative Krankheiten…53
  • Der Formenkreis der neurodegenerativen Krankheiten…55
  • Systematik der neurodegenerativen Krankheiten…55
  • Die Multiple Sklerose…57
  • Die Ursachen der Multiplen Sklerose…60
  • Die Vererbung…60
  • Die Infektionshypothese…60
  • Vitamin D und MS…61
  • Die Quecksilberbelastung und die Multiple Sklerose…62
  • Wissenschaftliche Grundlagen zur Ernährungstherapie bei Multipler Sklerose…64
  • Verlaufsformen der Multiplen Sklerose…69
  • Die Symptomatik der Multiplen Sklerose…71
  • Die Diagnose der Multiplen Sklerose…71
  • Die medikamentöse Therapie der Multiplen Sklerose…72
  • Die Ordnungstherapie der Multiplen Sklerose…75
  • Hilfsmassnahmen in der Krankenpflege, die Wasseranwendungen…78
  • Die Hydrotherapie für MS-Kranke Menschen…78
  • Die Darmentleerung…82
  • Zur allgemeinen Lebensführung bei Multipler Sklerose…84
  • Die Parkinsonsche Krankheit…86
  • Die Ursachen der Parkinsonschen Krankheit…87
  • Die Ernährung und die Parkinsonkrankheit…88
  • Die Symptome der Parkinsonkrankheit…90
  • Die Seelischen Auswirkungen des Parkinsonssyndroms…91
  • Die Sicherung der Diagnose der Parkinsonkrankheit…91
  • Atypische Parkinsonsyndrome…91
  • Die Therapie der Parkinsonschen Krankheit…92
  • Eine umfassende Therapie der Parkinsonkrankheiten…93
  • Die diätetische Therapie der neurodegenerativen Krankheiten…95
  • Empfehlungen für die Laborkontrollen für den behandelnden Arzt während der Diät98
  • Die praktische Anwendung der Rohkost-Therapie…102
  • Speisezettel…103
  • Menü-Zusammenstellungen bei verschiedenen Rohkost-Diätformen…103
  • Tagesmenü…105
  • Rezepte…107
  • Säfte…107
  • Birchermüesli…108
  • Früchte-Frischkorn-Speisen…110
  • Kaltschalen…110
  • Milcharten…111
  • Rohgemüse und Salate…111
  • Salatsaucen…112
  • Vorschläge für passende Saucen zu Salaten und Rohgemüse…115
  • Gekochte Speisen…116
  • Rezepte für gekochte Speisen…116
  • Gemüse…119
  • Salate von gekochten Gemüsen…124
  • Kartoffelgerichte…125
  • Getreidespeisen…126
  • Saucen…129
  • Belegte Brötchen…131
  • Rezeptverzeichnis…133
  • Literaturnachweis…137
  • Stichwortverzeichnis…149

Handbuch für Multiple-Sklerose-Kranke, Morbus Parkinson und andere neurodegenerative Leiden: Diesem Handbuch liegt das Wissen und die jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Bircher-Benner Handbuch 2 für Leber- und Gallenkranke

Umfassende Anleitung zur Pflege und Diät. Speisepläne und Rezepte aus einem Zentrum modernster Heilkunst des medizinischen Zentrums Bircher-Benner.

In den letzten Jahrzehnten hat die Zahl der Menschen, die an Leberkrankheiten oder deren Folgen leiden oder sich einer “empfindlichen Leber“ bewusst sind, stark zugenommen. (Li et al.)

Nur zum Teil ist dies die Folge epidemischer Leberentzündungen (Hepatitis) die nach scheinbarer Heilung oft einen dauernden Zustand von Überempfindlichkeit auf gewisse Nahrungsmittel, Blähungen und eine allgemeine Verminderung der Kräfte hinterlassen haben. Hinzu kommen jedoch die allgemein verbreiteten Ernährungsschäden, Alkohol, Arzneigifte und die sitzende Lebensweise mit mangelnder Durchblutung der Leber infolge zu flacher Atmung und ungenügender Körperbewegung sowie die nervöse Dauerspannung unserer Zeit, welche die Leber in ihrer Funktion belasten und die Wiederherstellung nach Schädigungen ganz bedeutend erschweren.

Der Leberkranke ist sich dessen bewusst, dass sich die Funktion der Leber in deren Anpassungsfähigkeit an die Nahrung widerspiegelt. Er weiss, dass Diätfehler unmittelbare Folgen haben. Die Folgen sind nicht nur örtliche Beschwerden in der Lebergegend, wie Blähungen, langsame Verdauung, Aufstossen, Spannungs- und Schweregehfühl, sondern auch eine empfindliche Störung des allgemeinen Lebensgefühls, der Lebensfrische und Leistungsfähigkeit, der Stimmung und des Erlebens der Beziehung zu anderen Menschen, Man fühlt sich nach einem Rückfall gedrückt, reizbar oder wehrlos, zieht sich in sich selbst zurück, oder man verletzt unbeabsichtigt andere Menschen und ist unfähig, etwas zu unternehmen.

Der Leberkranke beobachtet im allgemeinen, welche Speisen er meiden muss, er schont seine Leber so gut er kann. Nicht immer sind aber seine Schlussfolgerungen, seine Kenntnisse des Baus und der Funktion der Leber und sein Wille gut genug, um ihm zu erlauben, bedeutende Fehler der Lebensweise zu vermeiden, welche die Heilung seiner Leber-Gallenkrankheit verhindern.

Diesem kleinen Buch liegen nicht nur die neusten wissenschaftlichen Erkenntnisse zugrunde, sondern auch die über hundertjährigen praktisch-klinischen Erfahrungen der Bircher-Benner-Klinik. Dem Leser und der Leserin soll es alle Kenntnisse vermitteln, die sie nötig haben, um ihren eigenen Beitrag zur Heilung zu leisten.

Im diätetischen Teil finden sich Gerichte und praktische Speisezettel. Sie wurden in enger Zusammenarbeit der Diätküche mit den Ärzten der Bircher-Benner Klinik ausgearbeitet.

Die Rezepte überzeugen durch Geschmacks- und Abwechslungsreichtum. Die Leber-Gallendiät gereicht dem Kranken so zur Freude, dass er sie nicht als Einschränkung, sondern als eine Entdeckungsreise in eine neue Welt erfährt, eine gesunde, wohltuenden neue Art zu leben und sich zu ernähren.

Inhalte:

  • Vorwort zur 32. Auflage5
  • Einleitung7
  • Der Bau und die Funktion der Leber8
  • Der enterohepatische Kreislauf als Teufelskreis11
  • Die Aufgabe der Leber13
  • Wissensschaftliche Grundlagen der Ordnungstherapie
  • der Leber-Gallenkrankheiten...17
  • Die verschiedenen Krankheitsformen des Leber-Gallen-
  • symstems
  • Das allgemeine Erscheinungsbild der versagenden
  • Leberfunktion..23
  • Die Leberentzündung (Hepatits)25
  • Die Leberzirrhose (Schrumpfleber)28
  • Tumorerkrankungen der Leber..29
  • Gallensteine..30
  • Die Gallenblasenentzündung..31
  • Das Gallenblasenkarzinom.32
  • Die Gallengangsteine (Choledocholithiasis)..32
  • Das Postcholezystektomiesyndrom.33
  • Die Behandlung der Leber-Gallenkrankheiten
  • Pflanzliche Heilmittel (Phytotherapie, Spagyrik).34
  • Die Behandlung von Infektionen35
  • Die Hydrotherapie37
  • Die homöopathische Therapie, miasmatisch vererbte Folge
  • von Krankheiten und Traumen..45
  • Die neue wissenschaftliche Akupunktur.47
  • Die Neuraltherapie nach Huneke..48
  • Operative Verfahren50
  • Der Heilplan
  • Die Heildiät51
  • Die Behandlungder Hepatitis..53
  • Die Behandlung der Leberzirrhose..54
  • Die Behandlung der Gallenblasenentzündung54
  • Zur Vorbeugung und zur Vermeidung von Rückfällen54
  • Die vier Diätstufen
  • Die Diätstufe 1.58
  • Die Diästufe 2..60
  • Die Diätstufe 3.62
  • Die Diätstufe 4.64
  • Kleine Austauschtabelle für tierische Produkte, die bei
  • Diätstufe 3 weggelassen werden müssen..65
  • Die Rezepte
  • Säfte68
  • Gesundheits-Tees.70
  • Müesli..72
  • Rohgemüse und Salate..74
  • Salatsaucen..76
  • Milcharten.79
  • Butter, Pflanzenfette und Öle..80
  • Schonendes Kochen und Dämpfen.80
  • Suppen..81
  • Gemüse.85
  • Salat von gekochten Gemüsen91
  • Kartoffelgerichte.93
  • Getreidespeisen..96
  • Saucen..100
  • Belegte Brötchen102
  • Desserts..103
  • Rezeptverzeichnis107
  • Literaturverzeichnis..110
  • Stichwortverzeichnis..116

Handbuch für Leber-und Gallenkranke:
Diesem Handbuch liegt das Wissen und die jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Handbuch Nr. 4 für Frischsäfte, Rohkost und Früchtspeisen

Über neueste biophysikalische-wissenschaftliche Erkenntnisse zur Lebensenergie, Nahrunsenergie, Wirkung der lebendigen, vegetarischen Frischkost.

Viele Diätformen kommen eine Zeitlang auf, um dann wieder zu verschwinden. Die vitale vegetabile Frischkostdiät die Sie in diesem Handbuch kennen lernen werden, basiert dagegen auf solider wissenschaftliche Grundlage, die sich in den letzten 100 Jahren nur bestätigt und vertieft hat.
Am Ende des 19. Jahrhunderts entdeckte Dr.med. Maximilian Bircher-Benner, entgegen all seinen Erwartungen, fast zufällig die hohe Wirksamkeit ganz frisch zubereiteter, lebendiger Vegetabilien, wenn es um die Verhütung und Heilung der heute immer häufiger und immer früher auftretenden chronischen Krankheiten geht. Nach mehreren Jahren klinischer Erforschung, erkannte er, dass die lebendigen Vegetabilien eine ganz andere Nahrungsenergie enthalten müssen als die Verbrennungswärme (Kalorien). Bereits 1905 veröffentlichte er in Berlin seine erste, viel beachtete Ernährungslehre , nachdem er erkannt hatte, dass die Kalorien, das Mass der Wärmeenergie, die durch Verbrennung der Nahrungsmittel bestimmt wurde, zum Verständnis der Nahrungsenergie nicht ausreichen.
Die erstaunliche, heilende Wirkung seiner Diät erklärte er auf Grund seiner wissenschaftlicher Nachforschungen über mehrere Jahre mit dem zweiten Hauptsatz der Thermodynamik, dem Entropiegesetz . In der Tat ist es erstaunlich, dass unsere moderne medizinische Wissenschaft auch heute noch immer als einziges Mass für die Nahrungsenergie die Kalorien, die Verbrennungswärme kennt, während der zweite Hauptsatz der Thermodynamik auf allen anderen wissenschaftlichen Gebieten, in der Technik, der Physik und der Chemie seit 150 Jahren zur Basis aller energetischen Betrachtungen geworden ist.

Am Anfang des 20 Jahrhunderts, beherrschte die Furcht vor Ansteckung durch Bakterien die medizinische Welt, so dass man glaubte, es sei besser, alle Nahrung vor dem Verzehr zu kochen. Daraus ergaben sich neue Forderungen hygienischer Zubereitung der Rohkost. Als dann hitzelabile Vitamine und Vitalstoffe entdeckt wurden, bahnte sich Bircher-Benners Rohkostdiät ihren Weg zu weltweiter Anerkennung.

Die Erforschung der LASER-Amplifikation der Photonen in der Erbsubstanz der lebendigen Zellen ,5,6, und der Informationsleitung und -speicherung in der Grundsubstanz des Bindegewebes bestätigen Bircher-Benners Hypothese der Lichtakkumulation in lebendigen Nahrungsmitteln und der enormen Bedeutung der Photosynthese für den Energiewert der Nahrungsmittel als ordnende und damit heilende Information.

Eine weitere Bestätigung aus der Grundlagenforschung brachten unter anderem die Arbeiten des Nobelpreisträgers Ilya Prigogine über das dissipative System der lebenden Zellen, welche zeigten, dass das Streben aller physikalischen Vorgänge nach Unordnung (Entropiegesetz) in den lebendigen Zellen nicht gilt, da sie durch die Speicherung der Photonen aus der Photosynthese und die enorme rhythmische Verstärkung dieses Lichtes in den Zellen nach dem LASER-Prinzip in ihrer Energie so weit vom thermodynamischen Gleichgewicht entfernt werden, dass der zweite Hauptsatz der Energetik nicht gilt und das Chaosprinzip in ein ordnendes Kohärenzprinzip umschlägt.
In der Tat sind alle lebendigen Zellen der Natur der einzige Ort, wo aus kleinen, einfachen Molekülen komplexe, hochgeordnete Moleküle, Abläufe und Strukturen entstehen: wo aus Chaos Ordnung wird. Dies ist die grosse Bedeutung der Rohkostdiät, als einzige Diät, welche das ordnende Prinzip und die Ordnende Wirkung der lebendigen Zellen auf unser biologisches System überträgt und damit ihre grosse ordnende Heilwirkung entfaltet.

Hinzu kommt die hohe Nahrungsökonomie der lebendigen Pflanzennahrung, in welcher alle Nahrungsstoffe in geeigneten Mengenverhältnissen organisch gebunden und dadurch biologisch in höchstem Masse verfügbar werden, und wo die für die Assimilation der Vitalstoffe notwendigen Enzyme zugleich mitgeliefert sind, ihr hoher Gehalt an Polyphenolen, Carotinen und anderen Antioxidantien mit ihrer grossen, vor Degeneration und vor Genmutationen und damit vor Krebs schützenden Wirkung.
Alldem zu Folge ist nach unserer Erfahrung ein Gehalt unserer Nahrung an Rohkost von mindestens 70% am Beginn jeder Mahlzeit für die Erhaltung der Gesundheit notwendig.

Die reine Rohkostdiät ist in der Hand des Sachkundigen die ideale Heildiät zur Verhütung und Heilung aller degenerativen Krankheiten, die in unserer Zeit als „Zivilisationskrankheiten“ in ständiger Zunahme begriffen sind, ein Weg, der sich lohnt.

  • Einleitung 5
  • Zweierlei Nahrungsenergie7
  • Die neue Ordnung der Nahrungsmittel nach ihrem qualitiven Nährwert 9
  • Das Grundsystem des zarten Bindegewebes, Ursprung der Entstehung chronischer Krankheiten 11
  • Das Experiment im Royal Free Hospital in London 15
  • Einige weitere ausgewählte Beispiele wissenschaftlicher Untersuchungen zur Wirkung der Rohkosttherapie 19
  • Sekundäre Pflanzenstoffe, Arzneiwirkung pflanzlicher Nahrungsmittel 21
  • Zur Rohkosttherapie bei Gefahr von Thrombose und Embolie 26
  • Besonderheiten der Rohkosttherapie gegen Bluthochdruck 26
  • Besonderheiten der Rohkosttherapie zur Senkung des Cholesterinsspiegels 27
  • Zur Rohkosttherapie bei Diabetes mellitus 27
  • Zur Rohkosttherapie bei Infektionskrankheiten antimikrobielle Wirkung) 29
  • Zur Rohkosttherapie bei Immunschwäche und Infekt
  • anfälligkeit 29
  • Die Indikation zur Diät mit vegetabiler Frischkost
  • (Rohkost) 30
  • Die Diätstufe 1 32
  • Die Diätstufe 2 34
  • Formen vegetabiler Frischkost 35
  • Reaktionen auf die Umstellung auf die vegetabilen
  • Frischkostdiät und ihre Behandlung 37
  • Begleitende, allgemeine Empfehlungen zur vegetabilen
  • Frischsaftdiät 40
  • Die neue Gleichgewichtslage 41
  • Die verjüngende Wirkung der vitalen vegetabilen
  • Frischkost 44
  • Die richtige Anfangsdosierung 45
  • Das Thema der sogenannten "Rohkostintoleranz" 47
  • Die Zubereitung und Reinigung der Rohkost 47
  • Die Zusammenstellung der Rohkost 48
  • Die Anpassung an Geschmack und Kaufähigkeit 48
  • Die Reinigung der Rohkost 49
  • Von der Bircher-Raffel zur elektrischen Küchenmaschine 50
  • Speisezettel 51
  • Menü-Zusammenstellungen bei verschiedenen
  • Rohkost-Diätformen 51
  • Die Rezepte 55
  • Müesli 55
  • Früchte-Frischkorn-Speisen 57
  • Früchte-Speisen 57
  • Säfte 59
  • Schleim als Zusatz zu Säften 60
  • Milcharten 61
  • Saucen zu Rohgemüsen 62
  • Salatgerichte 62
  • Gesundheits-Tees 65
  • Stichwortverzeichnis 67
  • Literaturverzeichnis 68

Handbuch für Frischsäfte, Rohkost und Früchtespeisen.

Diesem Handbuch liegt das Wissen und die jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Bircher-Benner Handbuch 7 für Diabetiker

Diätanleitungen zur Verhütung und Therapie mit Rezeptteil, eingehende Ratschläge und ausgearbeiteter Kurplan aus einem ärztlichen Zentrum modernster Heilkunst.

Diesem Buch liegt ein grosses Erfahrungsgut zugrunde in der Behandlung von Menschen, die an Diabetes mellitus leiden.

Seit Dr. med. Maximilian Bircher-Benner vor über 100 Jahren die enorme Heilwirkung konsequenter Anwendung vegetabiler Frischkostdiät und geordneter Lebensweise entdeckt hat, sind an der Bircher-Benner-Klinik, heute medizinisches Zentrum Bircher-Benner, mehrere tausend Menschen geheilt worden, die an Diabetes des Typs II litten und deren Leben durch die Vielzahl der Folgekrankheiten und Komplikationen bedroht war.

In der ihr eigenen kommerziellen Geschäftigkeit stellt uns die pharmazeutische Industrie Medikamente und ausgeklügelte Injektionsapparate zur Selbstinjektion gentechnisch erzeugten Insulins bereit, die uns meistens erlauben, den Blutzuckerspiegel einigermassen zu kontrollieren.Dass aber die Diabetestherapie, so wie sie das derzeitige Paradigma der medizinischen Wissenschaft vorsieht, die Krankheit weder heilt, noch verhütet, ist aus der stetigen enormen Zunahme der Häufigkeit (Prävalenz) dieser Krankheit seit dem Ende des Zweiten Weltkrieges ersichtlich. Zwar sind die Ursachen des Diabetes mellitus und die Auswirkungen des „modernen“ Lebensstils und der Ernährung auf den Stoffwechsel und die Matrix des zarten Bindegewebes bereits gut erforscht, aber diese Erkenntnisse finden in der „modernen“ Diabetestherapie kaum Beachtung. Die medikamentöse Therapie geht nicht an die Ursache. Sie bekämpft nur das Symptom „Zuckerspiegel“.

Darum wird die Krankheit chronisch, tritt immer früher im Leben auf und wird immer häufiger. In den Industrie ländern betragen heute die Kosten für die Behandlung des Diabetes und seiner Folgen 20 % der gesamten „Gesundheitskosten“. In allen Gebieten westlicher Zivilisation ist der Diabetes eine eigentliche Volkskrankheit geworden. Deshalb spricht man auch von einer „ Epidemie des 20. Jahrhunderts“1. Im Jahr 1980 litten 153 Millionen Menschen an Diabetes mellitus2, 2013 waren es bereits 382 Millionen bzw. 8,3 % der Bevölkerung3. Prognostische Schätzungen mussten laufend nach oben korrigiert werden. Nur zu einem Drittel lässt sich diese Zunahme mit dem Älterwerden der Menschen erklären, das allerdings nicht durch eine verbesserte Gesundheit, sondern zu einem grossen Teil durch die verminderte Säuglingssterblichkeit und durch bessere Unfallverhütung zustande kam und nur zu einem kleineren Teil durch lebenserhaltende operative Eingriffe und Medikamente. Wohl können die schweren Folgekrankheiten mit der heute praktizierten pharmakologischen Therapie des Diabetes mellitus etwas hinausgezögert werden, aber die Krankheit schreitet dennoch stetig fort bis die schweren Folgen eintreten. Durch diese Tatsachen ist man gezwungen zu erkennen, dass die „moderne“ Diabetologie in ihrer Aufgabe,diese Krankheit zu verhüten und zu heilen, mindestens teilweise versagt hat.

Durch die allgemein verbreitete Fehlernährung werden die feinen Strukturen des zarten Bindegewebes mit den in ihr eingelagerten feinen Kapillaren durch Stoffwechselschlacken und Entzündung in der Zwischenzellsubstanz angegriffen, die molekularen Transportwege werden verlegt, so dass das Insulin seine Wirkung an den Rezeptoren der Zellmembranen allmählich verliert. Die Zellen werden gegen Insulin resistent, bei vermehrter Insulinproduktion. Lange können die Inselzellen der Bauchspeicheldrüse dies kompensieren, bis sie sich erschöpfen und zugrunde gehen. Die feinen Strukturen der Zellen und Interzellularräume und die Gefässwände werden nach und nach zerstört. Auch die Zwischenzellsubstanz der Leber füllt sich mit Stoffwechselschlacken. Dadurch gelangt das Cholesterin nicht mehr gut an die Leberzellen heran, so dass diese falsch tiefe Cholesterinwerte messen und die Cholesterinproduktion steigern. Die Störung des Zuckerstoffwechsels führt zu Bluthochdruck und Arteriosklerose. Es drohen Herz- und Hirninfarkte und ein Absterben von Gliedmassen durch Verschlüsse in den Beinarterien. Auch die feinen Strukturen der Augen werden angegriffen, bis zur Erblindung durch Glaukom, Retinopathie und Makuladegeneration. Auch die feinen Strukturen der Nervenscheiden erkranken, es kommt zu Empfindungsstörungen und Lähmungen ( diabetische Neuropathie).

Durch die Einlagerung degenerativer Eiweisse ( Amyloide) verdicken sich die Kapillarschlingen der Nieren, bis diese versagen ( diabetische Nephropathie). Gefässverschlüsse und Einlagerung von degenerativen Eiweissen (Amyloiden) in die Zwischenzellsubstanz des Gehirns gefährden Diabeteskranke frühzeitig für Demenz und die Alzheimerkrankheit.

Diabetes ist nicht eine eigenständige Krankheit. Er reiht sich ein in den gesamten degenerativen Prozess der Zivilisationskrankheiten. Nur in seltensten Fällen entsteht er als Teil einer unheilbaren Krankheit. In aller Regel ist der Diabetes mellitus des weitaus häufigsten 2. Typs die Folge einer Ernährungs- und Lebensweise, die den natürlichen Gegebenheiten unseres biologischen Systems widerspricht. Beginnt man frühzeitig genug mit der diätetischen Therapie, so lässt sich der Diabetes mellitus des viel häufigeren Typs II zuverlässig verhüten und heilen, auch wenn eine familiäre Belastung vorhanden ist.

Die Erkenntnisse Bircher-Benners sind durch wissenschaftliche Untersuchungen ständig ergänzt und überprüft worden, wobei sie sich gerade in neuester Zeit laufend bestätigen.
Dieses Buch erklärt in sorgsamer und dennoch gut verständlicher Weise die Ursachen und das Wesen der Zuckerkrankheit und gibt dem Leser alles nötige Wissen in die Hand, das ihm ermöglicht, an der Heilung seiner Krankheit aktiv mitzuarbeiten. Wirkliche Heilung ist nicht möglich, ohne eine grundlegende Vertiefung des Bewusstseins über den Sinn des Lebens, über den Sinn der Erkrankung, über die Ordnungen des Lebens, über die Beziehung zur Arbeit, zur Gesellschaft, zu sich selbst und zu den Menschen, mit denen wir leben. Am Anfang dieses Weges zur Heilung steht eine grosse Frage der Verantwortung den Mitmenschen und sich selbst gegenüber, sie wird zur Basis auf dem Weg zur Heilung des Diabetes mellitus, ein Weg, der sich lohnt. Für den behandelnden Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung und Begleitung seines Patienten.

Inhalt:

  • Vorwort
  • Das Wesen der Zuckerkrankheit (Diabetes mellitus)
  • Die Warnzeichen des Diabetes mellitus
  • Der Blutzuckerspiegel
  • Der Normwert des Blutzuckerspiegels
  • Die Messung des Blutzuckerspiegels
  • Der Glukosetoleranztest (oGTT)
  • Die Regulation des Blutzuckerspiegels
  • Die Korrektur eines zu hohen Glukosespiegels im Blut
  • Die Glukoseverwertung in den Mitochondrien der Zellen
  • Die Korrektur zu tiefer Blutzuckerspiegel
  • Die Wirkung von Stress auf den Blutzuckerspiegel
  • Die Zuckerausscheidung im Urin
  • Die Ausscheidung von Ketonkörpern im Urin
  • Die verschiedenen Arten von Diabetes mellitus
  • Der Diabetes mellitus des Typs 1
  • Die Ursachen des Diabetes Typ 1
  • Das Geschehen bei Diabetes des Typs 1
  • Die klinischen Symptome des Diabetes des Typs 1
  • Der Diabetes mellitus des Typs 2
  • Allgemein anerkannte Teilursachen des Typ-2-Diabetes
  • Genetische Risikofaktoren für eine Typ-2-Diabetes
  • Weitere Teilursachen, die in der Lebensweise liegen
  • Krankheit, Wundheilung, körperlicher Stress und Bewegungsmangel
  • Zuckerstoffwechsel und Arteriosklerose
  • Glykämischer Index und glykämische Ladung
  • Der glykämische Index (glycemic index GI)
  • Die glykämische Ladung (glycemic load,GL)
  • Die Folgekrankheiten des Diabetes mellitus
  • Die Körperlichen Schäden durch Zucker
  • Die exogene Glykation
  • Die endogene Glykation
  • Die endotheliale Dysfunktion und die Arteriosklerose
  • Die Spätfolgen des Diabetes mellitus im Herz-Kreislaufsystem
  • Bluthochdruck und Diabetes
  • Diabetes und Arteriosklerose
  • Das diabetische Fusssyndrom
  • Oydativer Stress im Zentrum der Ursachen neurodegenerativer Krankheiten und Demenz
  • Die diabetische Polyneuropathie
  • Die diabetische Retinopathie
  • Die diabetische Makulopathie
  • Konventionelle Therapien der Retinopathie
  • Operative Therapien bei diabetischer Retinopathie
  • Die diabetische Nephropathie
  • Allgemeine anerkannte Risikofaktoren für eine diabetische Nephropathie
  • Die Stadien der diabetischen Nephropathie (nach Mogensen)
  • Der Schwangerschaftsdiabetes
  • Allgemein anerkannt sind folgende Risikofaktoren
  • Die Schwangerschaft bei diabetischer Nephropathie
  • Die medikamentöse Therapie des Diabetes mellitus
  • Die Insulintherapie
  • Insulinarten
  • Die Methoden der Insulininjektion
  • Formen der Insulintherapie
  • Das Therapieprotokoll
  • Die Insulintherapie bei Schichtarbeit oder unregelmässigem Tagesrhythmus
  • Unerklärbare Blutzuckerschwankungen
  • Zur Insulintherapie des Typ-2-Diabetes
  • Die basal unterstützte orale Therapie (BOT)
  • Die Therapie mit der Insulinpumpe
  • Das Basis-Bolusprinzip
  • Die Insulinpumpe mit Hybrid-Close-Loop-System
  • Das Einstellen der Insulinpumpe
  • Die Sensorunterstützte Pumpentherapie (SuP)
  • Die Therapie des Diabetes Typ 1 und die allgemein anerkannte Therapieziele
  • Die Therapie des Diabetes des Typs 2
  • Die Entwöhnung vom Rauchen als Bestandteil der Basistherapie des Diabetes mellitus
  • Diabetes und Alkohol
  • Kaffee und Diabetes mellitus
  • Diabetes und Alkohol
  • Kaffee und Diabetes mellitus
  • Die Therapie des Diabetes Typ 2 nach den Leitlinien der deutschen Gesellschaft für Diabetes
  • Tabelle zum Idealgewicht
  • Das Idealgewicht erwachsener Männer
  • Das Idealgewicht erwachsener Frauen
  • Das Problem der Nahrungsenergie
  • Diabetesmedikamente (Antidiabetika), Wirkung und Nebenwirkungen
  • Nichtinsulinotrope Antidiabetika
  • Insulinotrope Antidiabetika
  • Zur Insulintherapie beim Diabetes des Typs2
  • Die Hypoglykämie
  • Die Therapie der Hypoglykämie
  • Die Ordnungstherapie des Diabetes mellitus
  • Zweierlei Nahrungsenergie
  • Das Grundregulationssystem des zarten Bindegewebes
  • Die Bedeutung der Nahrungsökonomie
  • Das Integralgesetz der Nahrung
  • Die Lebendigkeit der Nahrung
  • Sekundäre Pflanzenstoffe (Phytochemicals) mit antidiabetischer Wirkung
  • Der Mineralstoffwechsel beim Diabetes mellitus
  • Die Heilpflanzen für die Diabetestherapie
  • Die Bedeutung der Bewegung
  • Allgemeine Richtlinien zur Ordnungstherapie der Zuckerkrankheit
  • Zur Diät
  • Die Nahrungsmenge
  • Die Grundsätze der Bircher-Benner Diät und Ordnungstherapie für Diabetiker
  • Lebensordnung und Körpertraining
  • Die Hygiene
  • Wasseranwendungen, Anregung des Kreislaufs, Luft, Licht und Sonne
  • Die seelische Betreuung
  • Kurzzusammenfassung
  • 11 Grundregeln
  •  
  • DIE BIRCHER-BENNER DIABETESDIÄT
  • Allgemeines
  • DIÄT-REZEPTE FÜR DIABETIKER
  • Allgemeine Angaben
  • Broteinheiten und ihre Berechnung
  • Die Kohlenhydrateinheit
  • Zucker in der Diät
  • Rezeptteil
  • Rezepte für die vegetabile Frischkost (Rohkost)
  • Das Birchermüesli
  • Rohgemüse und Salate
  • Saucen zu Rohgemüsen und Salaten
  • Sauerkraut
  • Frischgetreide,
  • Frischsäfte
  • Pflanzen-Milch-Arten
  • Warme Speisen
  • Butter, Reform- Pflanzenfette und Öle
  • Suppen
  • Suppen-Einlagen
  • Gemüse
  • Salate von gekochten Gemüsen
  • Belegte Brötchen
  • Kartoffelgerichte
  • Getreidespeisen
  • Reisgerichte
  • Andere Getreidegerichte
  • Saucen
  • Süssspeisen
  • Tees
  • Anhang und Tabellen zur Diabetesdiät
  • Frischsäftetag
  • MENÜS für verschiedene Jahreszeiten
  • Anmerkung zur Menü-Gestaltung
  • Menüs im Winter
  • Menüs im Frühjahr
  • Menüs im Sommer
  • Menüs im Herbst
  • Berechnete Tagesmenüs für die Diabetesdiät (1200-2100K)
  • Tabelle zum glykämischen Index und der glykämischen Ladung
  • Rezeptverzeichnis
  • Literaturnachweis
  • Stichwortverzeichnis

Handbuch für Diabetiker

Diesem Buch liegt das Wissen und die jahrzentelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Handbuch 10 für Rheuma und Arthritiskranke

Über das Wesen der Rheumakrankheit, Moderne rheumatische Forschung, Umfassende Anleitung, Zur Pflege und Diät, Speisepläne und Rezepte.

Dieses Handbuch beruht einerseits auf einem großen Erfahrungsgut von Kranken, die durch die Birchersche Ordnungstherapie Heilung fanden; andererseits wurden die früheren Auflagen durch viele wertvolle Hinweise aus der Grundlagenforschung und durch klinische Ergebnisse der rheumatologischen Forschung ergänzt. Auch der diätetische Teil wurde sanft überarbeitet, ohne daß die hohe Qualität der Bircherschen Rezeptkunst verloren ging. Das Handbuch gibt den Kranken und ihren Angehörigen das unentbehrliche Wissen und die dringend nötige praktische Anleitung in die Hand, die es erfahrungsgemäß ermöglichen, den Krankheitsprozeß aufzuhalten und stetige Heilungsschritte einzuleiten.

Dem ganzheitlich behandelnden Arzt kann das Buch eine wertvolle Hilfe sein, wenn es um die Anleitung seiner Patienten zur Umstellung ihrer Lebensweise, zur Ordnungstherapie geht.
Seit Dr. med. Max Oscar Bircher-Benner wurde während rund hundert Jahren an der Bircher-Benner Klinik selbst und in privaten Arztpraxen die Ordnungstherapie der rheumatischen Krankheiten in sorgsamer Beobachtung der Heilungswirkungen erforscht. In all diesen Jahren waren die vielen tausend Patienten, die aus ihrer zur Verzweiflung führenden Krankheitsentwicklung herausfanden, unsere größten Lehrmeister. Mit starkem Willen zur Heilung führten sie die Anweisungen der Ordnungstherapie erfolgreich aus und ermöglichten die großen Erkenntnisse, die jetzt allmählich auch in der allgemeinen medizinischen Forschung bestätigt werden.

In der Neuordnung der Lebensweise hat die Ernährung eine erstrangige Bedeutung. Sie führt zu einer Regeneration der großen Regulationssysteme, zu einer neuen Öffnung zur Außenwelt und zu sich selbst, die erst das Ingangkommen der Heilungskräfte des Organismus, des Körpers und der Seele möglich werden läßt. Zitiert sei hierzu bloß eine Stelle aus Bircher-Benners Schrift „Vom Werden des neuen Arztes“: „Die Wunder der Seele bleiben jenen verschlossen, die dauernd die Ernährungsgesetze missachten. Von der Ernährung hängen Kraft und Tiefe der inneren Erlebnisse ab – das ist ihre eigentliche Bedeutung. Sich um seinen Körper, um seine Ernährung zu kümmern, hat keinen Zweck, es sei denn, daß daraus eine neue Entfaltung, ein Erwachen innerer Kräfte entstehe.“

Dr. med. Andres A. Bircher

  • Vorwort7
  • Einleitung9
  • Was ist Rheuma? 9
  • Ursprung des Rheumas ist die Erkrankung des weichen Bindegewebes (Mesenchym).10
  • Die biochemische Struktur des weichen Bindegewebes12
  • Die Verknüpfung des weichen Bindegewebes mit dem Hormonsystem und dem vegetativen Nervensystem..13
  • Das Experiment im Royal Free Hospital in London oder die wunderbare Wirkung der Bircherschen Rohkostbehandlung15
  • Die Patientin mit sekundär-chronischer Polyarthritis.16
  • Grenzen der Heilungsmöglichkeit.18
  • Wissenschaftliche Grundlagen der Ordnungstherapie der rheumatischen Krankheiten22"Der rheumatische Formenkreis" 27
  • Die chronische Polyarthritis (cP oder pcP)27
  • Die Spondylarthritis ankylosans (Morbus Bechterew)28
  • Die Psoriasisarthritis.28
  • Die juvenile chronische Arthritis....29
  • Die Kollagenosen oder Konnektivitiden 29
  • Die Polymyalgia rheumatice..30
  • Die Gicht.31
  • Der Weichteilrheumatismus..31
  • Infektiöse Arthritiden31
  • Die Arthrose32
  • Die Behandlung der rheumatischen Krankheiten33
  • Die Ordnung der Nahrungsmittel, der Mahlzeiten und der
  • Lebensweise.33
  • Die Befreiung von Infektherden und Schwer-
  • metallbelastung..36
  • Die Physiotherapie.38
  • Die Bewegungstherapie..38
  • Die Hydrotherapie..39
  • Der Kohlwickel..40
  • Der Quarkwickel40
  • Die Heilerde41
  • Die Heublumen41
  • Der Fango..41
  • Der Nackenguss nach Kneipp.42
  • Der Lendenguss nach Kneipp.42
  • Die Dampfkompresse nach Kneipp.42
  • Pflanzliche Heilmittel bei Rheuma.43
  • Die Behandlung von Infektionen..44
  • Die homöopathische Therapie.45
  • Die neue wissenschaftliche Akupunktur48
  • Manualtherapie, Chiropraktik und Osteopathie.48
  • Die Neuraltherapie nach Huneke.49
  • Medikamentöse Behandlung50
  • Die operative Behandlung.53
  • Der Heilplan54
  • Die Heildiät.54
  • Zur Vorbeugung und zur Vermeidung von Rückfällen55
  • Die vier Diätstufen58
  • Die Diätstufe 1.58
  • Die Diätstufe 2.60
  • Die Diätstufe 3.62
  • Kleine Austauschtabelle für tierische Produkte, die bei Diät-
  • stufe 3 weggelassen werden müssen..63
  • Die Diätstufe 4.64
  • Die Rezepte.66
  • Säfte ..67
  • Müesli.69
  • Rohgemüse
  •  
  • und Salate.72
  • Salatsaucen.74
  • Milcharten77
  • Butter,Pflanzenfette und Öle. Schonendes Kochen und
  • Dämpfen.78
  • Suppen..80
  • Gemüse.85
  • Salate von gekochten Gemüsen...95
  • Kartoffelgerichte.97
  • Getreidespeisen.100
  • Saucen..105
  • Belegte Brötchen108
  • Süssspeisen...109
  • Gesundheits-Tees..115
  • Rezeptverzeichnis..117
  • Literaturverzeichnis.119
  • Sachregister.122

Handbuch für Rheuma-und Arthritiskranke:
Diesem Handbuch liegt das Wissen und die jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Bircher-Benner (Hand)buch Nr.14 für Magen- und Darmkranke mit Rezeptteil und ausgearbeiteter Kurplan aus einem ärztlichen Zentrum modernster Heilkunst.

Diätanleitung für gesunde und kranke Tage, eingehende Ratschläge.

Magen und Darm sind dem Menschen nicht nur für die Einverleibung von Speise und Trank gegeben, sie bilden auch ein umfassendes, wohl aufgebautes, mehrfach gestuftes Vorwerk unseres Organismus in seiner Selbstbehauptung gegenüber den krankmachenden Einflüssen der Umwelt. Der ganze Verdauungstrakt beherbergt so zu sagen eine innere Aussenwelt, die durch unseren Körper hindurch dringt und ihn unzähligen mechanischen, chemischen und mikrobiellen Reizen und Einflüssen aussetzt, gegen die er sich abgrenzen und sich wehren muss. Der Bau, die zellulären und biochemischen Funktionsweisen des Magen-Darmtraktes sind genial konzipiert, um der ständigen Unterscheidung von Fremd und Eigen, von Nützlichem, Lebensnotwendigem und Schädlichem, Zerstörerischem, das durch ihn hindurch dringt, gewachsen zu sein, ein Meisterwerk der Natur. Über Jahrmillionen entstanden, ist auch die Symbiose, das Zusammenwirken unseres Darmes mit den etwa 20 Billionen Keimen unserer Darmflora, einem komplexen Oekosystem, ohne das kein Überleben möglich wäre. So lange unser Verdauungssystem gut erhalten und einsatzbereit ist, sind wir auch vor vielen Folgen, Mängeln und Fehlern in der Ernährung geschützt. Sind Magen- und Darm geschwächt oder erkrankt, so werden sie zur Ursache allgemeiner Kränklichkeit, denn damit gerät das ganze biologische System nach und nach aus seinem komplexen, dynamischen Gleichgewicht. Darum müssen Magen- und Darmkranke Menschen in ihrer Ernährungsweise sehr sorgfältig sein. Sie müssen die Gesundheit des Darmmilieus möglichst rasch wieder herstellen, um nicht in den folgenden Jahren an allgemeinen, degenerativen Krankheiten zu leiden. Von einer energetisch und stofflich gesunden Ernährung, von einem gesunden biochemischen und mikrobiellen Milieu im Verdauungstrakt hängt das ganze komplexe System unseres Stoffwechsels ab, die Erhaltung unserer Grundregulation, der gesamte Energie- und Informationsfluss im biologischen System unseres Körpers. Die Qualität der Nahrung entscheidet über unser Schicksal, über Regeneration oder Degeneration, über gesund oder krank.

In dieser Handbuchreihe geht es darum, das nötige Wissen zu vermitteln, um zu verstehen, wie die in unserer Zeit immer häufiger und immer früher im Leben auftretenden chronischen Krankheiten verhütet und geheilt werden können. Zur praktischen Anwendung findet man zusammengefasst vorbeugende und heilende Diätanweisungen und Massnahmen, welche die Selbstheilungsbemühungen des Organismus unterstützen und steuern. Unsere Erklärungen und Anweisungen beruhen auf den bis heute zugänglichen wissenschaftlichen Erkenntnissen.
In Jahrzehnte langer Erfahrung sind unsere Diätanweisungen verfeinert. Sie erweisen sich als äusserst wirksam. Klar und gut verständlich wird gezeigt, wie zur Heilung von Magen-Darmkrankheiten in der Praxis vorgegangen werden muss. In jedem Falle empfehlen wir eine enge Zusammenarbeit mit Ihrem behandelnden Arzt. Für ihn ist dieses Buch eine wertvolle Hilfe bei der Betreuung seines Patienten.

Braunwald, 22.Januar 2014 Dr. med. Andres Bircher

Inhalt:

Vorwort...7

  • Der Bau des Verdauungssystems...8
  • Der Mund...8
  • Die Speiseröhre...9
  • Der Magen...9
  • Der Zwölffingerdarm (Duodenum)..9
  • Die Bauchspeicheldrüse (Pankreas)...10
  • Das Jejunum...10
  • Das Ileum...11
  • Der enterohepatische Kreislauf...11
  • Der Dickdarm (Kolon)............12
  • Das Immunsystem des Darms...............12
  • Die Darmflora...13
  • Die Regulation des Verdauungssystems...13
  • Die hormonelle Regulation der Verdauung...14
  • Erkrankungen der Speiseröhre...15
  • Schluckstörungen...15
  • Die Refluxkrankheit und der Zwerchfellbruch (Zwerchfellhernie)..15
  • Der Barrett-Oesophagus (Endobrachyoesophagus)...15
  • Die Therapie der Refluxkrankheit und des Barrettsyndroms..15
  • Der Ösophaguskrebs (Oesophaguscarcinom)...16
  • Erkrankung des Magens...17
  • Die Magenentzündung (Gastritis)...17
  • Der übersäuerte Magen (chronische Gastritis)...17
  • Der säurearme, schlaffe Magen...17
  • Die Fehlbesiedlung des Magens mit Helicobacter pylori...18
  • Der Magenkrebs...18
  • Erkrankungen der Bauchspeicheldrüse...20
  • Die akute Bauchspeicheldrüsenentzündung (akute Pankreatis)...20
  • Die chronische Pankreatitis...20
  • Der Pankreaskrebs.(Pankreaskarzinom)...20
  • Das Versagen der Bauchspeicheldrüse (Pankreasinsuffizienz)...20
  • Erkrankung des Darms...22
  • Das Zwölffingerdarmgeschwür (Ulcus duodeni)...22
  • Der Darmkatarrh (Enteritis, Colitis, Gärung, Fäulnis)...22
  • Darmträhgheit und Durchfall...23
  • Darmfäulnis und Gärung, die bakterielle Fehlbesiedlung...24
  • Die Fehlbesiedlung des Dünndarms...25
  • Die Darmfäulnis...25
  • Die Therapie der bakteriellen Fehlbesiedlung...26
  • Die Blinddarmentzündung...27
  • Die Blähsucht (Meteorismus)...27
  • Das Reizdarmsyndrom...29
  • Die Zölliakie (Hertersche Krankheit)...30
  • Die Laktoseintoleranz...33
  • Die Fruktoseintoleranz...34
  • Die Histaminintoleranz...35
  • Das Problem der Nahrungsmittelallergie...36
  • Die Crohn'sche Krankheit...37
  • Die Colitis ulcerosa...42
  • Die Divertikelkrankheit (Divertikulose)...46
  • Der Dickdarmkrebs (Colon-Karzinom)...47
  • Die Wirkung der Nahrung auf den Verdauungstrackt...50
  • Zweierlei Nahrungsenergie...50
  • Allgemeine Richtlinien für die Therapie der Darmerkrankung...53
  • Die Rohapfelkost (besonders bei Durchfallerkrankungen)...53
  • Die Rohkostdiät...53
  • Die Sauermilchdiät...54
  • Hinweis zur Auswahl der Nahrungsmittel...54
  • Kostformen...56
  • Kost 1 Teefasten...56
  • Kostform 2 Säftekost...56
  • A. Bei Akutem Durchfall...56
  • B. Bei übersaurem Magen, Ulcuskrankheit...58
  • C. Bei Säurearmem Magen...59
  • Kostform 3 Pürierte Kost (Breiform)...60
  • Kost 4 Schon-Heilkost...62
  • Kost 5 Schutz-Heilkost...63
  • Die Dauerdiät bei Neigung zu Verstopfung...64
  •  
  • Die Rezepte...66
  • Säfte...66
  • Gesundheits-Tees...67
  • Birchermüesli...68
  • Rohgemüse und Salate...70
  • Salatsaucen...72
  • Vorschläge für passende Saucen zu Salaten und Rohgemüse...74
  • Milcharten...75
  • Butter, Pflanzenfette und Öle-Schonendes Kochen und Dämpfen...75
  • Suppen...76
  • Gemüse...80
  • Salate von gekochten Gemüsen...86
  • Kartoffelgerichte...88
  • Getreidespeisen...90
  • Saucen...93
  • Belegte Brötchen...95
  • Desserts...96
  • Vorschläge von Speisezetteln geordnet nach verschiedenen Konsistenzformen.100
  • Zusammenfassung der Lebensmittel für Heildiät von Verdauungsleiden...104
  • Indikationen zu allgemeinen Anwendungen bei Magen-Darm-Krankheit...106
  • Bäder...106
  • Reibesitzbad nach Kuhne...106
  • Wechselwarmes Fussbad...106
  • Kaltes Halbbad...106
  • Waschungen...107
  • Kalte Bauchwaschung...107
  • Ganzwaschung...107
  • Leibwaschung...107
  • Unterleibswaschung...107
  • Bauchwaschung...107
  • Kalte Güsse...108
  • Schenkelguss...108
  • Unterleibsguss nach Winternitz...108
  • Wickel...108
  • Leibwickel,(Rumpfwickel) nach Kuhne und Priessnitz...108
  • Kompressen und Auflagen...109
  • Dampfkompresse nach Kneipp...109
  • Massagen...109
  • Die Bauchmassage nach Winternitz...109
  • Diättabelle für Magen-Darmkranke...110
  • Literaturverzeichnis...114
  • Rezeptverzeichnis...119
  • Stichwortverzeichnis...12

Produktinformationen zu „Bircher-Benner-Handbuch: Bd.14 Bircher-Benner Handbuch für Magen-und Darmkranke“.

Diesem Handbuch liegt das Wissen und die Jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute medizinisches Zentrum Bircher- Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohl- schmeckenden, erprobten, ab- wechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Bircher-Benner: (Hand)buch Nr.19 für Bluthochdruck, Herz- und Arteriosklerosekranke

Diätanleitungen zur Verhütung und Heilung mit Rezeptteil, eingehende Ratschläge und ausgearbeiteter Kurplan aus einem ärztlichen Zentrum modernster Heilkunst.

Diesem Handbuch liegt ein großes Erfahrungsgut zu Grunde in der Behandlung von Menschen, die an Herz- und Kreislaufkrankheiten litten und – so dies noch möglich war – durch die BircherBennersche Ordnungstherapie Heilung fanden. Die früheren Auflagen wurden durch viele Hinweise und Erkenntnisse aus der klinischen, epidemiologischen und der Grundlagenforschung ergänzt. Auch der diätetische Teil wurde sanft überarbeitet, ohne dass die hohe Qualität der Bircherschen Rezeptkunst verloren ging. Dieses Buch gibt denjenigen Menschen das nötige Wissen und die unentbehrliche praktische Anleitung in die Hand, die bereit sind, die frühen Zeichen und Risikofaktoren der Herz- und Kreislauferkrankung ernst zu nehmen und wissen wollen, wie sie aus dieser Krankheitsentwicklung herausfinden können, um dem Drama schwerer Behinderung oder des Todes durch einen Herzinfarkt oder Hirnschlag zu entgehen.

Seit Dr. Maximilian Oscar Bircher-Benner wurde während über hundert Jahren an der Bircher-Benner-Klinik selbst und in privaten Arztpraxen die Ordnungstherapie der Herz-Kreislaufkrankheiten in sorgsamer Beobachtung der Heilungswirkungen erforscht. In all diesen Jahren waren die vielen tausend Patientinnen und Patienten, die aus ihrer Krankheitsentwicklung herausfanden, unsere größten Lehrmeiser. Mit starkem Willen zur Heilung führten sie die Anweisungen der Ordnungstherapie erfolgreich durch und ermöglichten so die großen Erkenntnisse, deren Bestätigung sich erst jetzt allmählich auch in der allgemeinen medizinischen Forschung zeigt. Unsere Erfahrung, dass der Bluthochdruck durch unsere Diät rückbildungsfähig ist und dass die Arteriosklerose auch in den Herzkranzgefäßen durch eine langzeitige und sorgsame Anwendung unserer Diät rückbildungsfähig ist, ist nun seit gut 2 Jahr zehnten wissenschaftlich einwandfrei belegt.

In der Neuordnung der Lebensweise hat die Ernährung eine erstrangige Bedeutung. Sie führt zu einer Regeneration der großen Regulationssysteme, zu einer neuen Öffnung zur Außenwelt hin und zu sich selbst, die erst das Ingangkommen der Heilungskräfte des Organismus, des Körpers und der Seele, möglich werden lässt. Zitiert sei hier eine Stelle aus Bircher-Benners Schrift „Vom Werden des neuen Arztes“: „Die Wunder der Seele bleiben jenen verschlossen, die dauernd die Ernährungsgesetze missachten. Von der Ernährung hängen Kraft und Tiefe der inneren Erlebnisse ab – das ist ihre eigentliche Bedeutung. Sich um seinen Körper, um seine Ernährung zu kümmern, hat keinen Zweck, es sei denn, dass daraus eine neue Entfaltung, ein Erwachen innerer Kräfte entstehe.“

Gerade bei den Kreislaufkrankheiten hat die ganze weitere Lebensordnung große Bedeutung. Wirkliche Heilung ist nicht möglich, ohne eine grundlegende Vertiefung des Bewusstseins über den Sinn des Lebens, über die Ordnungen des Lebens, über die Beziehung zur Arbeit, zur Gesellschaft, zu sich selbst und zu den Menschen, mit denen wir leben. Am Anfang dieses Weges zur Heilung steht eine große Frage der Verantwortung den Mitmenschen und sich selbst gegenüber: ein Weg, der sich lohnt.

Für den behandelnden Arzt ist dieses Buch eine große Hilfe bei der Anleitung und Begleitung seines Patienten.
Dr. med. Andres Bircher

Inhalt:

  • Vorwort zur 17. Auflage..8
  • Einleitung..10
  • Das gesunde Herz, ein erstaunliches Organ..13
  • Das Herz und seine Aufgaben..13
  • Der Körperkreislauf..14
  • Der Lungenkreislauf..15
  • Die Kapillaren und die Grundsubstanz des zarten Bindegewebes..15
  • Degeneration und Regeneration. Die Antiquiertheit der Kalorienrechnung..16
  • Die Arteriosklerose, eine Volkskrankheit..18
  • Die Risikofaktoren für kardiovaskuläre Krankheiten..19
  • Das Problem geringer Alkoholmengen..19
  • Oxydativer Stress, eine wichtige Mitursache..21
  • Was ist Arteriosklerose eigentlich genau, wie entsteht sie?..22
  • Die Bedeutung des Fettstoffwechsels, der Adipositas und des Cholesterins..23
  • Die Bedeutung der Fettsäuren..27
  • Gesättigte Fettsäuren..27
  • Ungesättigte Fettsäuren..27
  • Einfach ungesättigte Fettsäuren..27
  • Mehrfach ungesättigte Fettsäuren..28
  • Die pharmakologische Wirkung der Omega-6-und Omega-3-Fettsäuren..29
  • Das geeignete Verhältnis der mehrfach ungesättigten Fettsäuren zueinander..29
  • Das Risiko der Oxidation der hochungesättigten Öle..30
  • Das Problem von Pflanzenmargarinen, Rahm und Butter..30
  • Die Bedeutung des Cholesterins..31
  • Der Cholesterinstoffwechsel..31
  • Die Wirkung der Ernährung auf die Cholesterinspiegel im Blut..32
  • Cholesterinstoffwechselstörung und Gallensteine..34
  • Cholesterin und die Koronare Herzkrankheit..34
  • Die Bedeutung der Eiweissstoffe und die Amyloidose..39
  • Die Bedeutung der Kohlenhydrate und des Zuckers für die Arteriosklerose..40
  • Die Bedeutung der vegetabilen Nahrung zur Verhütung der koronaren
  • Herzkrankheit..42
  • Die Wirkung von Mandeln und Nüssen gegen die Arteriosklerose..42
  • Die Bedeutung von Obst und Gemüse gegen die Arteriosklerose..43
  • Die antioxydative Wirkung der pflanzlichen Rohkost, die grosse Bedeutung der so genannten sekundären Pflanzenstoffe..43
  • Die Bedeutung der Vollkorngetreide..44
  • Die Bircher-Bennersche Heildiät und Ordnungstherapie..45
  • Der Bluthochdruck (Hypertonie)..48
  • Die Regulation des Blutdrucks..51
  • Die pulmonale Hypertonie..53
  • Die medikamentöse Therapie der Hypertonie..54
  • Die Angina pectoris..58
  • Die stabile Angina pectoris..58
  • Die instabile Angina pectoris..58
  • Die Verhütung und Therapie des Herzinfarkts..59
  • Die Angina pectoris..58
  • Die stabile Angina pectoris..58
  • Die instabile Angina pectoris
  • Die Verhütung und Therapie des Herzinfarkts..59
  • Der Herzinfarkt..60
  • Die Risikofaktoren für einen Herzinfarkt..61
  • Die Betreuung eines Menschen mit Herzinfakrt..61
  • Komplikationen des Herzinfakts..61
  • Die Verhütung des Herzinfarkts..62
  • Die Herzinsuffizienz oder das chronische Herzversagen..63
  • Die diätetische Therapie der Herzinsuffizienz..63
  • Die Herzklappenfehler..64
  • Die Mitralklappenstenose..65
  • Die Mitralklappeninsuffizienz..66
  • Die Aortenklappenstenose..67
  • Die Aortenklappeninsuffizienz..68
  • Die Pulmonalklappenstenose..69
  • Die Tricuspidalklappeninsuffizienz..69
  • Entzündliche Krankheiten des Herzens..71
  • Die Herzmuskelentzündung (Myocarditis)..71
  • Toxische Herzmuskelschäden..71
  • Autoimmunentzündungen des Herzens..71
  • Die Symptome der Herzmuskelentzündung, Therapie und Prognose..71
  • Die Endokarditis..71
  • Das Aneurymsa..73
  • Das Aneurysma dissecans der Aorta..73
  • Aneurysmen der Hirnschlagadern..73
  • Der Schlaganfall (Apoplexie)…74
  • Die Nierenarterienstendose..76
  • Die Karotinsstenose..77
  • Die periphere arterielle Verschlusskrankheit (PAVK)..78
  • Herzrhythmusstörungen..79
  • Supraventriukläre Extrasystolen..80
  • Ventrikuläre Extrasystolen..80
  • Vorhofflattern und Vorhofflimmern (absolute Arrhythmie)..80
  • Die Tachykardie..82
  • Entzündungen der Arterien..84
  • Die Vaskulitis..84
  • Regulative Therapien der Naturheilkund für Herz-und Kreisklaufkranke..87
  • Klimatherapie und Terrainkuren..87
  • Die Hydrotherapie..87
  • Die klassisch homöopathische Therapie..88
  • Die neue wissenschaftliche Akupunktur..89
  • Die Neuraltherapie..90
  • Allgemeine Richtlinie zur Behandlung und Verhütung der Arteriosklerose
  • Und der Herz-Kreislaufkrankheiten..91
  • Die Heildiät..93
  • Sekundäre Pflanzenstoffe..100
  • Speisezettel..102
  • Menü-Zusammenstellungen bei verschiedenen Rohkost-Diätformen..102
  • 1. Frischsaftfasten (Bett-Safttag)..102
  • 2.Vollsaft-Tag..102
  • 3. Früchte-Fasttage..102
  • 4. Rohkost-Menüs (für die Diätstufe 2)..104
  • Tagesmenu..104
  • Tabelle zur Rohkostdiät..106
  • Die Rezepte..107
  • Fruchtsäfte..107
  • Gemüsesäfte..108
  • Kartoffelsäfte..108
  • Schleim als Zusatz zu Säften..108
  • Birchermüesli..108
  • Gekeimte Getreidekörner..110
  • Rohgemüse und Salate..111
  • Salatsaucen…112
  • Tabelle zur Wahl geeigneter Salatsaucen…115
  • Milcharten..116
  • Pflanzenfette, Öle und Butter…116
  • Schonendes Kochen und Dämpfen..117
  • Suppen..117
  • Gemüse..121
  • Salate von gekochten Gemüsen..126
  • Kartoffelgerichte..127
  • Getreidespeisen..129
  • Saucen..132
  • Belegte Brötchen..135
  • Desserts..135
  • Gesundheits-Tees..139
  • Rezeptverzeichis..141
  • Literaturnachweis..144
  • Sachregister..152

Handbuch für Bluthochdruck,Herz- und Arteriosklerosekranke: Diesem Handbuch liegt das Wissen und die jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Bircher-Benner Handbuch Nr. 24 für die Verhütung der Demenz und Alzheimerkrankheit

Diätanleitungen zur Verhütung und Therapie mit Rezepteil, eingehenden Ratschläge und ausgearbeiteter Kurplan aus einem ärztlichen Zentrum modernster Heilkunst.

Unsägliches Leid bringt die Demenz über uns Menschen. Vom Leben geprüft, nachdem wir viel geleistet, viel durchgestanden haben und uns auf einen ruhigen, wohlverdienten Lebensabend freuten, da ergreift sie uns erbarmungslos und nimmt uns den Verstand. Wir verstehen die Welt nicht mehr, nicht die Angehörigen nicht uns selbst. Ergriffen von Angst und Sinnestäuschungen verlieren wir jedes Vertrauen, das Vertrauen in uns selbst, das Vertrauen in all diejenigen, die einst uns achteten, die Geborgenheit und Heimat uns schenkten. Immer grösser wird die Not, bis nicht einmal mehr wir selbst uns pflegen, unser Alltägliches verrichten können, umgeben von Menschen deren Namen uns entfallen sind, die wir kaum mehr erkennen, nicht einmal unser eigenes Kind.
Als im Jahre 1906 der deutsche Psychiater und Neuropathaloge Alois Alzheimer erstmals“ einen seltenen Fall von Demenz, eine eigenartige Krankheit der Hirnrinde“ beschrieb, wurde dies kaum beachtet. Heute ist dieses Leiden eine gefürchtete Volkskrankheit.

Über die Ursachen ist man sich nicht einig. Nicht zu übersehen ist aber, dass diese stetige Zunahme der Alzheimerkrankheit auch der vaskulären Demenz und der Parkinsonkrankheit in allen Ländern westlicher Zivilisation vorhanden ist.

Bei allen häufigen Demenzformen, der Alzheimerkrankheit, der vaskulären Demenz, der LEWY-Körperchen-Demenz, welche im Rahmen der Parkinsonkrankheit auftritt und der selteneren Multisystematrophie (MSA), spielt die Vererbung kaum eine Rolle. Ohne die Parkinsonkrankheit und die Multisystematrophie mit einzubeziehen, leiden rund 2/3 der Demenzkranken an Alzheimer-und 1/3 an vaskulärer Demenz.

Den neurodegenerativen Krankheiten gemeinsam ist ein meist langsames Fortschreiten durch degenerative Entzündungsprozesse in unterschiedlichen Regionen des Nervensystems. In den letzten dreissig Jahren hat eine Vielzahl wissenschaftlicher Arbeiten immer mehr Teilursachen der Alzheimerkrankheit aufgezeigt. Die vaskuläre Demenz entsteht durch die Arteriosklerose, durch Gefässverschlüsse, Embolien und Blutungen ins Gehirn. Die Alzheimerkrankheit folgt im Wesentlichen denselben Risikofaktoren wie die Arteriosklerose. Es sind die Auswirkungen der allgemein verbreiteten unnatürlichen Lebens- und Ernährungsweise, wie Bewegungs- und Schlafmangel und in erster Linie einer artfremden, industriell verkünstelten Nahrung mit viel tierischen Produkten wie viel Fleisch, Ei und fettem Käse, Mangel an mehrfach ungesättigten Pflanzenölen und an den Vitaminen A, B, C,D,E und Folsäure und Mangel an antioxydativ und entzündungshemmenden sekundären Pflanzenstoffen aus frischer, roher, lebendiger Pflanzennahrung, bei hohem oxydativem Stress. Für die Alzheimerkrankheit und die LEWY-Body-Demenz der Parkinsonkranken sind die heute bedrohlich gewordenen Belastunge durch Umwelttoxine wie Schwermetalle, Pestizide, Reiz-,Suchtmittel und Medikamente zusätzlich von hoher ursächlicher Bedeutung.
Im Fokus medizinisch-wissenschaftlichen Denkens über die neurodegenerativen Krankheiten stehen vor allem Autoimmunprozesse, das heisst die zerstörenden Angriffe des Immunsystems auf körpereigene Strukturen des Nervensystems, auf Nervenzellen und die empfindlichen myelinhaltigen Nervenscheiden. So kann man verstehen, dass alle therapeutischen Anstrengung zur Bekämpfung z.B. der Multiplen Sklerose sich auf die medikamentöse Unterdrückung der krankhaften Autoimmunentzündung konzentriert. Bei der Alzheimerkrankheit stehen oxydative Vorgänge im Fokus, welche gewisse Eiweisse durch Phosporylierung unlöslich machen, so dass sie sich ins Zwischenzellgewebe und in die Nervenzellen einlagern und diese zerstören. Mit Milliardenbeträgen wird soweit erfolglos nach Medikamenten geforscht, welche diese degenerative Phosphorylierung verhindern sollen. Nur geringe finanzielle Mittel stehen dagegen zur Erforschung der eigentlichen Ursachen der Alzheimerkrankheit und einer Therapie der Ursachen zur Verfügung. Trotz des
Immensen finanziellen Aufwandes der medizinisch-pharmakologischen Forschung, schreitet die Krankheit stetig fort und breitet sie sich immer mehr aus.

Aber in jüngster Zeit beginnt die medizinische Wissenschaft auch die grossen geographisch-epidemiologischen Unterschiede in der Häufigkeit der Alzheimer- und der Parkinsonkrankheit ernst zu nehmen und zu verstehen. Man hat erkannt, dass diese Krankheit nicht durch Vererbung, sondern durch Unterschiede in der Ernährungs-und Lebensweise und Umweltbedingungen erklärbar sind. All diese Daten und eine Vielzahl neuer wissenschaftlicher Studien weisen auf eine grosse Bedeutung der in den westlichen Industrieländern allgemein verbreiteten Fehlernährung als Ursache hin. Die Ursachen, die Verhütung und Therapie der Multiplen Sklerose, der amyotrophischen Lateralsklerose, des Guillain-Barré-Syndroms und der Parkinsonkrankheit werden im Bircher-Benner Handbuch Nr.1 beschrieben.

Diesem Buch liegen alle modernen wissenschaftlichen Erkenntnisse zu Grunde, welche für das Verständnis, die Verhütung und eine wirksame ursächliche Therapie der Demenzkrankheiten wichtig sind. Hinzu kommen über hundert Jahre ärztlicher Erfahrung. Die vielen Patienten, die in dieser langen Zeit an der berühmten Bircher-Benner Klinik in Zürich und in unserem medizinischen Zentrum durch unsere vitale vegane Frischkost , neue Lebensordnung und sorgsame Elimination von toxischen Belastungen, Krankheitsherden und Störfeldern erfolgreich behandelt wurden, waren unsere grössten Lehrmeister. Dem kranken und seinen Angehörigen gibt dieses Buch alles nötige Wissen und die praktische Anleitung in die Hand, um die Demenzkrankheiten zu verhüten oder wenn sie schon entstanden sind, deren Verlauf positiv zu beeinflussen. Dem behandelnden Arzt ist dieses Buch eine bedeutende Hilfe bei der Anleitung und Führung seiner Patienten.

Inhalt:

  • Vorwort...7
  • Einleitung…9
  • Der Aufbau des zentralen Nervensystems..10
  • Das Grosshirn…10
  • Das Kleinhirn (Cerebellum)..10
  • Die Brücke…11
  • Die Basalganglien…11
  • Der Thalamuskern…11
  • Die Substantia nigra…12
  • Das limbische System…12
  • Die motorischen Bahnen…13
  • Die sensiblen Bahnen…13
  • Die hormonbildenden Drüsen des Gehirns…13
  • Der Hypophysenvorderlappen (Adenohypophyse)…13
  • Der Hypophysenhinterlappen (Neurohypophyse)…14
  • Die Zirbeldrüse (Epiphyse) und das Melatonin…14
  • Die Nervenzelle (Neuron)…14
  • Das Aktionspotential…15
  • Die Synapsen…16
  • Erregende Botenstoffe…16
  • Hemmende Botenstoffe…16
  • Die Bedeutung der Gliazellen im Gehirn…16
  • Die Hohlräume des Gehirns und die Flüssigkeit im Gehirn
  • und im Rückenmark…17
  • Die Blut-Hirnschranke…18
  • Die Myelin-Markscheiden, eine empfindliche Substanz…23
  • Demyelinisierende Erkrankungen…24
  • Remyelinisation…25
  • Krankheiten durch die Einlagerung von degenerativen Eiweissen…26
  • Die TAU-Proteine…26
  • Die Amyloidose…26
  • Die Wirkung der Ernährung auf das zentrale Nervensystem…28
  • Zweierlei Nahrungsenergie…28
  • Das Grundregulationssystem des zarten Bindegewebes im zentralen
  • Nervensystem…30
  • Oxydativer Stress im Zentrum der Ursachen der neurodegenerativen Krankheiten.32
  • Der Einfluss der Umweltbelastung durch Schadstoffe als Ursache für die neurogenerativen Krankheiten…34
  • Die neurotoxische Wirkung des Quecksilbers…34
  • Organische Zinnverbindungen und Neurodegeneration…35
  • Chlor und neurodegenerative Krankheiten…36
  • Die neurotoxische Wirkung flüchtiger organischer Kohlenwasserstoffe…37
  • Pestzide und neurodegenerative Krankheiten…39
  • Holzschutzmittel und neurodegenerative Krankheiten…39
  • Neurotoxische Medikamente und Neurodegeneration…39
  • Legale und verbotene Drogen und neurodegenerative Krankheiten…40
  • Cannabis…40
  • Amphetamine…40
  • LSD (Lysergsäure-Diethylamid)…40
  • Heroin, Morphium, andere Opiate…41
  • Kokain…41
  • Nikotin…41
  • Alkohol…41
  • Koffein…42
  • Zum Phänomen der Primär- und Sekundärwirkungen und der Gefahr
  • Medikamentöser Polypragmasie…43
  • Die Kombinationswirkung neurotoxischer Schadstoffe…44
  • Vitamine, Spurenelemente und neurodegenerative Krankheiten…45
  • Die Vielfältigkeit der Ursachen der neurodegenerativen Krankheiten…47
  • Der Formenkreis der neurodegenerativen Krankheiten…48
  • Systematik der neurodegenerativen Krankheiten…48
  • Die Demenz…50
  • Die Diagnose der Demenz…50
  • Demenzformen…50
  • Demenz wird immer häufiger..51
  • Offiziell anerkannte Risikofaktoren der Demenz..51
  • Die Symptomatik der Demenz…52
  • Die Diagnostik der Demenz…53
  • Hinweise zur Betreuung und Pflege demenzkranker Menschen…54
  • Die Alzheimerkrankheit…60
  • Ursachen der Alzheimerkrankheit…61
  • Das Geschehen im Gehirn bei der Alzheimerkrankheit…61
  • Die Symptomatik der Alzheimerkrankheit…61
  • Die Krankheitsstadien…63
  • Die Diagnose der Alzheimerkrankheit…63
  • Nicht jeder Gedächtnisverlust im Alter ist eine Alzheimerkrankheit…63
  • Das Früh- und Mittelstadium der Alzheimerkrankheit…63
  • Das fortgeschrittene Stadium der Alzheimerkrankheit…64
  • Die Wesensveränderung durch die Alzheimerkrankheit…64
  • Der körperliche Zerfall des Alzheimerkranken…64
  • Die Lebensprognose bei Alzheimerkrankheit…66
  • Prophylaxe und Therapie der Alzheimerkranken..64
  • Die offiziell anerkannten Risikofaktoren der Alzheimerkrankheit…66
  • Die Ordnungstherapie der Alzheimerkrankheit…66
  • Die diätetische Therapie der neurodegenerativen Krankheiten…66
  • Empfehlung für die Laborkontrollen für den behandelnden Arzt während
  • Der Diät…71
  • Die praktische Anwendung der Rohkost-Therapie…75
  • Speisezettel…75
  • Tagesmenü…77
  • Rezepte…79
  • Säfte…79
  • Birchermüesli…80
  • Früchte-Frischkorn-Speisen…82
  • Kaltschalen…82
  • Milcharten…83
  • Rohgemüse und Salate…83
  • Salatsaucen…84
  • Vorschläge für passende Saucen zu Salaten und Rohgemüse…87
  • Gekochte Speisen…88
  • Rezepte für gekochte Speisen…88
  • Gemüse…88
  • Salate von gekochten Gemüsen…91
  • Kartoffelgerichte…96
  • Getreidespeisen…97
  • Saucen…98
  • Belegte Brötchen…103
  • Desserts…104
  • Rezeptverzeichnis…109
  • Literaturnachweis…113
  • Stichwortverzeichnis…121

Produktinformationen zu „Bircher-Benner-Handbuch: Bd.24 Bircher-Benner Handbuch für die Verhütung der Demenz und Alzheimerkrankheit“.

Diesem Handbuch liegt das Wissen und die Jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute medizinisches Zentrum Bircher- Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohl- schmeckenden, erprobten, ab- wechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten .


Ordnungsgesetze des Lebens

Dr. med. Max Bircher-Benner

In ungeahntem Mass ist die Entwicklung der Medizin heute an ihre Grenzen gestossen. Der Gesundheitszustand der Menschen hat sich trotz eines kaum mehr tragbaren Aufwandes im Gesundheitswesen zwar verändert, aber nicht wirklich gebessert. Unsere moderne Medizin war fähig, lebensbedrohliche Situationen aufzufangen. Sie war fähig, grosse epidemische Krankheiten einzudämmen. Aber an ihre Stelle sind andere chronische Leiden getreten. Früher denn je erkranken unsere Patienten an degenerativen und chronischen Leiden, denen wir Ärzte trotz unseres grossen Arsenals an Medikamenten mehr oder weniger machtlos gegenüber stehen.

Es gelingt uns, deren Symptome teilweise zu lindern, Komplikationen zu verzögern, aber nicht wirklich, sie zu verhüten oder gar zu heilen.
Im Bericht der Weltgesundheitsorganisation WHO vom 5. Mai 1997 hiess es bereits: „ Die chronischen Krankheiten haben weltweit zugenommen und die infektiösen Krankheiten breiten sich weltweit aus: Hunderte von Millionen Menschen werden in den kommenden Jahren Opfer von Krebs, Herz- und Kreislaufkrankheiten sein, sowie von Erkrankungen der Atemwege. “ Allein in den EU-Ländern berechnet man damals für die folgenden 25 Jahre eine Zunahme des Brustkrebses um 30% und des Prostatakrebses um 40%. Ähnlich sah man die Prognose für die Herz-Kreislaufkrankheiten, die Adipositas, den Diabetes und für andere degenerative Krankheiten, etwa des rheumatischen Formenkreises, der Leberzirrhose, den Autoimmunkrankheiten, der Neurodermitis und den Allergien.

11 Jahre später, in den WHO-Statistiken von 2008 sieht es nicht anders aus: „ 80% der vorzeitigen Todesfälle gehen zu Lasten chronischer Krankheiten( inklusive Herzkreislaufkrankheiten, Hirnschlag und Krebs) Die statischen Prognosen zeigen, dass die Anzahl Todesfällen an chronischen Krankheiten in ständiger die Zunahme begriffen sind und zwar für Männer und Frauen in gleicher Weise…2015 sollen auch in den Entwicklungsländern die nicht übertragbaren chronischen Krankheiten (NCDs) die führende Todesursache sein.“
Bei aller Bewunderung für die Meisterschaft und das Genie der medizinischen Technik und Pharmakologie, können wir Ärzte nicht mehr übersehen, dass unsere moderne Medizin in ihrer Aufgabe, die häufigsten Krankheiten unserer Patienten zu verhüten und sie heilen, versagt hat.

In unangenehmer Weise führt uns das multiple Leiden unserer Patienten ins Spital und ambulanter Sprechstunde den Mangel unserer Methode vor Augen. Wir kommen nicht mehr lange darum herum, unser wissenschaftliches Paradigma, die Richtigkeit unseres sorgsam gelernten Verständnisses der Biologie des Menschen und seiner Krankheiten, mindestens teilweise, in Frage zu stellen.
Die massive Zunahme der chronischen Krankheiten unserer Zivilisation trotz immer grösseren, kaum mehr tragbaren Aufwandes zeigt, dass ein grundlegendes Missverständnis zwischen unserer medizinischen Wissenschaft und der biologischen Natur des Menschen bestehen muss.

Noch weitgehend ist das wissenschaftliche Paradigma unserer Zeit von Maschinenmodell René Descartes geprägt. Wohl hat die rein materielle Betrachtung und Zerlegung des Menschen in einzelne, den Organen zugeordnete Funtionsbereiche und Fachgebiete ihre Berechtigung. Doch verführt sie uns machmal zu fragmentarischem Denken, mit der Gefahr, die Auswirkungen einer spezialärztlichen Massnahme auf andere Organbereiche und auf das biologische System des Menschen, das auf jeden Reiz als Ganzes reagiert, zu übersehen.
Mit energetischen Betrachtungen hatte Descartes gründlich aufgeräumt. Die Existenz einer Seele wurde nach ihm ernsthaft in Frage gestellt. Psychische Zustände waren Nervenkrankheiten, seelische Zusammenbrüche „ Nervenzusammenbrüche“. Sie wurden dem Nervenarzt zugewiesen. Erst zweihundert Jahre später gab es dann den Seelenarzt, den Psychiater und erst dreihundert Jahre später die Psychosomatik. Noch leidet unser ärztliches Denken manchmal unter dieser künstlichen Trennung. Finden wir Ärzte über oft längere Zeit nichts somatisches, so sprechen wir von „supranasal“ und weisen den Patienten dem Psychiater zu.

Inzwischen haben die Molekularbiologie und die Biophysik bei der Erforschung energetischer Phänomene im biologischen System grosse Erkenntnisse erzielt, welche unserem klinisch- wissenschaftlichen Paradigma zum Teil diametral entgegenstehen: Der Nachweis der intrazellulären Lichtspeicherung und der intrazellulären Phtonenamplifikation nach dem Laserprinzip und die Molekularbiologische Erforschung des Extrazellularraumes, der Grundsubstanz des zarten Bindegewebes, mit ihrer dichten Netzstruktur aus Proteoglykanen und Glucosaminen als Molekuarsieb und als Leitungssystem komplexer informationen im biologischen System, welche die Funktionsweise der biochemischen Abläufe steuert sind wissenschaftlich anerkannten.
Die Erkenntnisse des Nobelpreisträgers Ilya Prigogine über den Umschlag biochemischer Systeme aus dem Chaosprinzip in ein ordnendes Kohärenz unter dem Einfluss hochgeordneter Energie (Lichtenergie) sind mit dem derzeitigen medizinischen Paradigma nur teilweise vereinbar. So ist es nicht erstaunlich, dass sie von den medizinisch forschenden Ärzten kaum beachtet worden sind.
Der Einbezug energetischer Kenntnisse wird das Paradigma unserer medizinischen Wissenschaft verändern. Kalorien als Mass chaotischer Verbrennungsenergie werden als Mass für die Nahrungsenergie ausgedient haben. Der zweite Hauptsatz der Energetik, das Entropiegesetz wird in der Ernährungslehre und Diätetik Einzug erhalten. Nahrungsmittel werden neu nach ihrem Gehalt an hochgeordneter Energie, nach ihrer Nähe zur Photosynthese beurteilt werden, nach ihrem Gehalt an biologisch ordnender Information.
Der Eigentliche Gegensatz zwischen unserer universitären medizinischen Wissenschaft und derjenigen einer wissenschaftlich forschenden Naturheilkunde und Komplementärmedizin liegt in der Frage der Energie.

Die heilende Wirkung vitaler pflanzliche Frischkost (Rohkost) ist klinisch vielfach belegt.
Ohne grundlegendes Verständnis der immateriellen Informationsübermittlung im biologischen System kann es nicht gelingen, die immaterielle, rein informative Wirkung homöopathischer Arzneien zu verstehen. Man wird damit fortfahren, die Homöopathie als blosse Placebowirkung oder Scharlatanerie lächerlich zu machen. Die energetische Grundregulation in der Grundsubstanz des mesenchymalen Bindegewebes und deren direkte Auswirkung auf das Neurovegetativum und die hormonale und interzelluläre Regulation bildet die wissenschaftliche Grundlage der regulativen Naturheilkunde und Komplementärmedizin.

Die Ausbereitung der regulativen Wirkung erfolgt kybernetisch. Damit können die meist einfachen, linearen Denkansätze der aktuellen medizinisch- wissenschaftlichen Forschungsmethodik nicht mithalten. Es brauche neue Ideen, neue Modelle, ein grundlegend neues wissenschaftliches Verständnis, neue Ansätze und Definitionen für unsere „ Evidence based Medicine“. Dies ist die Bedeutung der Naturheilkunde und Komplementärmedizin für das neue Paradigma, die neue medizinische Schule.
Schon am Anfang des 20. Jahrhunderts hat Maximilian Bircher-Benner als wissenschaftlich scharfsinnig denkender und forschender Arzt mit einem Erfahrungshintergrund aus der erfolgreichen Therapie viel tausend Menschen diese Grenze des damaligen und heue noch immer unveränderten wissenschaftlichen Paradigmas erkannt und ganz neue Wege aufgezeigt. Damals wurden seine Erkenntnisse weltweit sehr beachtet. Doch haben der zweite Weltkrieg und die Entdeckung der Cortisontherapie und der Antiobiotika die medizinischen Schulen in anndere Richtungen geleitet, denn vorerst glaubte man, damit alle Krankheiten heilen zu können.

Das Buch“ Ordnungsgesetze des Lebens“, das aus seinen drei grossen Londoner Vorträgen von 1938 entstanden ist, enthält faszinierende Erkenntnisse diese grossen Pioniers, die heute aktueller sind denn je und zeigt unserer modernen medizinischen Wissenschaft und allen suchenden Menschen einen Weg aus ihrer Sackgasse, einen Weg zu einem ganz neuen wissenschaftlichen Denken und Verständnis der Biologie des Menschen, der Krankheitsursachen und ganz neue Wege der Therapie.

Braunwald, im November 2013
Dr. med. Andres Bircher

Vorwort
Vorwort des Verfassers
1. Vortrag:
Sie wusste nicht, warum sie krank wurden
1. Das Organisationsgesetz der Nahrung
2. Das Gleichgewichtsgesetz der Ernährung
3. Das Ökonomiegesetz
4. Das Mundgesetz
5. Das Ordnungsgesetz des Hautorgans
6. Das Ordnungsgesetz der Lungen
7. Das Ordnungsgesetz der Beziehung zur Schwerkraft
8. Das Ordnungsgesetz des Lebensrhythmus
9. Das Ordnungsgesetz des Seelenlebens


2. Vortrag:
Die Hölle der Ungesundheit
Unordnungskrankheiten:
1. Die Rachitis oder englische Krankheit
2. Die Möller-Barlowsche Krankheit Säuglinge
3. Die Herter-Heubnersche Krankheit oder Coeliakie
4. Die Darmträgheit, Konstipation, Darmfäulnis, intestinale Toxaemie, Colitis, Colibazillose
5. Die Eingeweidesenkung oder Glendardsche Krankheit
6. Die Zahnkaries und ihre Folgen. Die Oralsepsis
7. Die Zahnbetterkrankung, Zahnlockerung, Zahntascheneiterung
8. Schädigungen und Krankheiten der Blutkreislauforgane
9. Blutkrankheiten
10.Infektionskrankheiten
11. Krankheiten infolge gestörter Harmonie und Erkrankung der Einsonderungsdrüsen
12. Stoffwechselkrankheiten
13. Hautkrankheiten
14. Allergische Krankheiten
15. Steinleiden
16. Schwangerschaftsstörungen, Frauenleiden und Fortpflanzungsstörungen,
17. Angeborener Schwachsinn, Wachstumshemmungen und Missbildungen
18. Erkrankung der Sinnesorgane
19. Die rheumatischen Krankheiten
20. Geisteskrankheit
21. Seelenkrankheiten, Psychoneurosen
22. Substanzkrankheiten des Nervensystems
23. Die Krebskrankheit

3. Vortrag:
Die Rückkehr ins Reich der Ordnungen
Das Gesunden
Schlussfolgerungen
Die Richtlinien der Ordnungstherapie:
1. Heilernährung
2. Ordnung der Beziehungen zur unbelebten Umwelt
3. Ordnung des Seelenlebens
Nachtrag
Nachwort

Den Inhalt dieser drei Vorträge widme ich den Kranken und Leidenden, welche wissen wollen, woher ihre Not kam und noch Entschlossenheit und Selbstüberwindungskraft genug besitzen, um den hier gezeigten Rückweg zur Gesundheit zu gehen. Ich widme ihn auch meinen verehrten Kollegen und allen denkenden und klugen Menschen, welche hören wollen, wie das Elend der Ungesundheit verhütet werden kann.

Daß von Tausenden von kranken Menschen, deren Not ich kennen lernte, nicht einer, selbst nach langer Vorbehandlung, wußte, warum er krank geworden war und weshalb seine Krankheit nicht weichen wollte, zeigt den erstaunlichen Mangel an Lebens- und Gesundheitskunde der Menschen unserer Zeit bis hinauf in die gebildeten und gelehrten Stände. Ich kann Nietzsche nicht widersprechen, wenn er sagt:
»Nein, die Stunde dafür ist noch nicht gekommen. Noch fehlen vor allem die Ärzte, für welche das, was wir bisher praktische Moral nannten, sich in ein Stück ihrer Heilkunst und Heilwissenschaft umgewandelt haben muß; noch fehlt allgemein jenes hungrige Interesse an diesen Dingen, das vielleicht einmal dem Sturm und Drang jener alten religiösen Erregungen nicht unähnlich erscheinen wird; noch sind die Kirchen nicht im Besitz der Pfleger der Gesundheit; noch gehört die Lehre von dem Leibe und von der Diät nicht zu den Verpflichtungen aller niederen und höheren Schulen;. . .«
Mit diesen drei Vorträgen wird die frohe Botschaft verkündet, daß die Stunde, die Nietzsche sah, nun kommt. Doch müssen ihr alle, die Gesunden, die Kranken und die Ärzte, den Weg bereiten: die ersteren dadurch, daß sie ihre Aufmerksamkeit und ihr Denken der Lehre vom Leibe und von der Diät, von der Herkunft der Ungesundheit und der Rückkehr ins Reich der Ordnungen, dem Preis, der für die Wiedergesundung bezahlt werden muß, zu¬wenden; die letzten dadurch, daß sie sich mit Herz und Hand der Reformation der Heilkunde, sowohl hinsichtlich Diagnose und Therapie, als auch im ärztlichen Denken, hingeben. Ohne ernste Bemühung und Arbeit wandelt sich nichts.

Körperliche und seelische Leiden haben einen Sinn; ihn erkennen und erfüllen - das ist der Weg.

Den zweiten Vortrag habe ich bei der Niederschrift für die Drucklegung wesentlich erweitert.
Die Übersetzung in die englische Sprache besorgten die beiden Damen Fräulein D. Hecht und Fräulein Dr. med. E. F. Meyer in London, denen ich hier meinen wärmsten Dank ausspreche. Mit höchster Anerkennung und Dankbarkeit möchte ich hier auch der vielen Dienste gedenken, welche mir durch den ehrenamtlichen Sekretär der Food Education Society, Herrn Charles E. Hecht, zuteil geworden sind. Unvergeßlich bleiben mir meine drei Präsidenten: Sir Robert McCarrison, Captain Elliston, M. P. und Herausgeber des Medical Officer, und Dame Louise Mclllroy, M. D., sowie die Sprecher aus Ärzte- und Krankenpflegekreisen am Schlüsse des dritten Vortragsabends. Eine schöne Überraschung aber bedeutete mir die Stunde im Royal Free Hospital, da mir der Rheumafilm mit den nur mit meiner Heildiät behandelten Patienten durch Dr. Pillman Williams vorgeführt wurde.

Dr. med. Maximillian Oskar Bircher-Benner


Bircher-Benner Leben und Lebenswerk

Wegbereiter der neuen Ernährungslehre und Heilkunde.

Zum Geleit:
„ Das Wirken dieses grössten Arztes gleicht einer lodernden Flamme, die das Feuer der Erkenntnis in vielen Menschen entzündete und die über unsere Generation hinweg auf die nachfolgenden Geschlechter wirken wird.“

So schrieb Prof. Dr. med. W. Heupke in der Münchner Medizinischen Wochenschrift zum Hinschied Dr. M. Bircher-Benners. Worin bestanden die „Grösse“, das „ Feuer“ und die „ Wirkung“ dieses Mannes? Wenige wissen darüber Bescheid, selbst unter seinen Freunden und Anhängern. Darum habe ich mich in diesem Buche bemüht, eine Vorstellung von diesem Leben und Lebenswerk, von seiner Beweggründen und Zielen, Selbstüberwindungen und Erfüllungen zu geben, indem ich das Wesentliche so objektiv und einleuchtend herauszuarbeiten suchte, als das einem Sohne möglich ist. Jene, die ihn als“ Vater einer neuen Ernährungslehre“ oder als Pionier eines neuen Arzttums“-oder wie die öffentlichen Kennzeichnungen lauten mögen- kennen, finden hier erstmals alles in Kürze von der heutigen Kenntnis aus betrachtet, zusammengestellt. Für die Öffentlichkeit aber , die nicht viel mehr als den Namen kennt, und besonders für die Jungen, suchte ich das Eigentliche und wie ich glaube, Wertvollste an diesem Leben herauszuarbeiten: wie man die Furche vor den Menschen verliert! Mancher hat Wertvolles in sich und kann es nicht aus sich herausstellen, weil er die Menschen fürchtet, vielleicht, ohne dass ihm das bewusst wird, Unserer Zukunft hängt von denen unter uns, besonders unter den Jungen ab, die diese wunderbare Freiheit finden.

Dr. Ralph Bircher

Inhaltsverzeichnis:

Vorwort vom Prof. Zabel
Zum Geleit
Rezept Dr. Bircher-Benners für einen Patienten im Jahre 1896
Der Start
Die Wunde
Der Maturand
Der Rückschlag
Das Medusenhaupt
Der Zeitgeist und das Unzeitgemässe
Sprung in die Praxis
Die Entdeckung
Der Aufbruch ins Unbekannte
Ziel in Sicht
Lebens-Nahrung
Kalorien täuschen!
Das kostbare „ Etwas“
Die neue Nährwertlehre
Die Versuchung
Ein Vorläufer
Ein neuer Vorstoss
Drei Ziele
Das „ Prophetische“
Das „ Erzieherische“
„Du sammle still und unerschlafft im kleinsten Punkt die grösste Kraft“
Kleiner Zwischenakt
Hintergrund und Wirkung
Bircher-Benners Lehre
Die Ordnungsgesetze des Lebens
1. Das Ordnungsgesetz der Nahrungsenergie
2. Integral-Gesetz der Nahrung
3. Das Ökonomie-Gesetz der Ernährung
4.Das Ordnungsgesetz der Nahrungspforte
5.Das Ordnungsgesetz der Mahlzeitenzahl
6. Das Ordnungsgesetz der Atmung
7. Das Ordnungsgesetz der Beziehung zum Licht
8. Das Ordnungsgesetz der Beziehung zur Temperatur
9. Das Ordnungsgesetz der Beziehung zu Schwerkraft
10. Das Ordnungsgesetz der Beziehung zu den Umweltrhythmen
Vom Wesen der Krankheit und der Gesundheit
Die Brücke zur Therapie
Vom Gesamtheilplan
„Suggestion“ und „ Induktion“
„Ausgespanntheit“
„Was ist aus meinem Lebenswerk geworden?“
Die Grösse der Arzt-Berufung
Danksagung von Prof. Kollath
Stiftungsurkunde

Die Lehren Bircher-Benners auf dem Gebiet der gesundheitsschaffenden Ernährung, der heilenden Lebensordnung und des neuen Arzttums sind in kurzen Zusammenfassungen zusammengestellt und vom heutigen Stand aus besprochen. Erstaunlich, was Bircher-Benner alles als erster erkannt, formuliert und verwirklicht hat, wovon Nachfolgende glauben, es neu zu entdecken! Höhepunkt der Darstellung sind die Kapitel über die Entdeckung des Heilwertes der Rohkost, die er als erster gezielt ausgewertet hat, jener über das “Prophetische“, das Erzieherische“, den Hintergrund“ und die „Ausgespanntheit“. Das Schönste an diesem Lebensbild, besonders für Junge, ist wohl, wie die Furcht vor der Meinung der Menschen überwunden wurde. Die geistige Freiheit, die daraus entstand, ermöglichte eine ungeahnte Entfaltung der Gaben.


Vom Werden des neuen Arztes

Dr. med. Max Bircher-Benner

Vorwort zur Neuauflage 2014

Als Maximilian Bircher-Benner dieses bedeutende Werk niederschrieb, lagen vier Jahrzehnte ärztlichen Schaffens hinter ihm, in denen er das Leiden und die Biographie Zehntausender erfahren und verinnerlicht hatte und sie auf ihrem Weg zur Heilung angeleitet und begleitet hatte. Mit wissenschaftlichem Scharfsinn und einer aussergewöhnlichen Fähigkeit, unabhängig von vorgegebenen Meinungen zu denken, war er stets auf der Suche nach der Wahrheit. Die seltene Gabe, seine Patienten sowohl mit Intuition und Einfühlung, als auch mit genialer intellektueller Klarheit zu erfassen, machten ihn zu einem grossen Arzt und Pionier wissenschaftlich fundierter Naturheilkunde. Unsere moderne Medizin versteht Krankheitssymptome als Feind, den es zu bekämpfen gilt.

Die medizinischen Diagnosen sind in aller Regel ein reiner Symptomenbeschrieb. Von da aus geht der Weg der Weg meist direkt zu den Medikamenten, wenn nicht zur Chirurgie. Genau wie vor 70 Jahren, als Bircher-Benner dieses Buch geschrieben hat, wissen auch heute die Patienten, die zu uns in die Behandlung kommen nicht, warum sie krank geworden sind, denn die gemeinsame Suche nach den Ursachen war noch immer meistens ausgeblieben. Maximilian Bircher-Benner hat schon in jungen Jahren verstanden, dass die Symptome nicht die Krankheit sind, sondern der Ausdruck einer immensen Anstrengung der Lebenskraft, die dazu angetan ist, die vorhandene Störung der Ordnung im biologischen System des erkrankten Menschen zu beseitigen. Damit richtet sich der Blick des Arztes auf das Gesunde im Menschen, auf seine Lebenskraft und das ärztliche Handeln auf die Unterstützung der Heilungskraft. Die globalen Statistiken der WHO belegen seit vielen Jahren eine ständige Zunahme aller chronischen Krankheiten in allen Ländern, wo moderne Medizin betrieben wird. Chronische Krankheit, entsteht da, wo das biologische System den Rückweg aus entstandener Unordnung nicht findet. Symptomunterdrückung richtet sich gegen die Heilungsanstrengung des biologischen Systems und damit gegen die Lebenskraft. Die ständige Zunahme der chronischen Krankheiten belegt eindrücklich, dass ein „ Missverständnis“ besteht, zwischen unserem aktuellen medizinisch Paradigma und der Biologie des Menschen. Bei aller Anerkennung des Genies der medizinischen Technik und der Pharmakologie war unsere moderne Medizin nicht in der Lage, die häufigsten Krankheiten zu verhüten und zu heilen. Vor über 70 Jahren hat dies Maximilian Bircher-Benner bereits erkannt und einen“ Neuen Arzt“, eine neue medizinische Schule gefordert, ein neues wissenschaftliches Paradigma, ein Umdenken, für welches erst heute die Zeit reif geworden ist. So gehört dieses Vermächtnis genauso wie der hippokratische Eid in die Hand jedes werdenden Arztes. Ein faszinierendes Werk für alle Denkenden und Suchenden, die nicht mit allen Entwicklungen unserer modernen Medizin Schritt halten können. Ein lebendiges Buch, das uns gefesselt hält.

Braunwald, den 2. April 2014 Dr.med. Andres Bircher

nhalt
Vorwort zur Neuauflage 2013
Vorwort zur Neuausgabe 1989
Vorwort

1 Einleitung
Anlage- Kindheits-und Jugenderlebnisse als Richtungsimpulse-
Gewöhnung an unablässige, mannigfaltige Arbeit- Berufswahl

2 Das Medizinstudium
Das Wunder des Lebens - Enttäuschung – Abstinenz – Hypnose und Suggestion

3 Die Praxis
Krankheitsnot und Versagen der Therapie – Irrtümer, Unwissenheit und
Ihre Überwindung

4 Die Lösung der Ernährungsfrage
Nährwert-Umwertung-Ungesundheit durch Missernährung-
Ernährungskrankheiten-Heilernährung

5 Ordnungstherapie
6 Psychotherapie

7 Der neue Arzt als Körper- und Seelenarzt

8 Unterschiede in der Heilbehandlung

Max Oskar Bircher-Benner

Ein biographischer Abriss von Dr. Ralph Bircher

Literatur

Dieses Buch dieses genialen Arztes und Pioniers einer wissenschaftlich fundierten Naturheilkunde, der in seiner Klinik tausenden Menschen aus der ganzen Welt zur Heilung ihrer chronischen Leiden verholfen hat, die als unheilbar gegolten hatten, ist hochaktuell. Es zeigt den biographischen Weg vom gut ausgebildeten Mediziner zum“neuen Arzt“ , der in der täglichen Praxis und Therapie seiner Patienten eine ganz neue ganzheitliche Sicht des Menschen, seiner Biologie und seiner Seele erkannt hat, eine geniale Sichtweise, die den Ausweg aus der Sackgasse in der sich unsere moderne Medizin und unser „Gesundheitssystem“ heute befindet, aufzeigt.


Geheimarchiv der Ernährungslehre

Heraus aus dem Labyrinth der Ungesundheit.

Heraus aus dem Labyrinth der Ungesundheit:
Gesundheit- was ist das?- wie erkennt man sie? – wo findet man sie?
Diese Frage ist heute brennend geworden, brennender wohl als je. Denn trotz phänomenaler Fortschritte in Forschung, Medizin, Schulung, und Technik der Krankheitsbekämpfung stehen wir vor allseitiger Klage über einen drohenden Zusammenbruch des „ Gesundheitswesens“, so wie es gemeinhin verstanden wird.

Der gesunde Menschenverstand sagt uns zwar, dass Gesundheit sicherlich zum Allerpositivsten gehört, was man sich denken kann. Fülle und Erfüllung des Lebens. Aber in praxi stehen wir vor einer paradoxen Situation. Nach einer massgebenden Prominenz-Prof. Bauer-ist „Medizin entweder naturwissenschaftlich, oder sie ist nicht“, nach einer anderen-Prof. Rothschuh in seiner „Theorie des Organismus“- ist Gesundheit mit naturwissenschaftlichen Methoden grundsätzlich nicht fassbar, und nach einer dritten-Prof. V.v. Weizsäcker- können wir mit unseren derzeit angewandten Methoden dem Wesen des Lebens und der Gesundheit nicht näher kommen als ein Bergwerk dem Mittelpunkt der Erde.

Es bedarf also vor allem einer Ausweitung der Wissenschaft über die analytisch-messenden und statistischen Methoden der Naturwissenschaft hinaus, eine neue, umfassendere Wissenschaftlichkeit, die aber ähnlich zuverlässige Ergebnisse ermöglichen muss. Sonst bleibt unser „ Gesundheitswesen“ in einer fatalen Sackgasse.
Schon Nietzsche rief nach einer anderen, positiven Gesundheitslehre, und seit drei Generationen suchen namhafte Ärzte, Denker und Erzieher nach einer entsprechenden Ausweitung der Wissenschaft über das rein naturwissenschaftliche, analytisch-messende hinaus und haben auch da und dort neue Methoden mit verlässlichen Ergebnissen erarbeitet. Seit Jahrzehnten auch haben immer wieder höchste Fachgremien die positive und nicht nur als Fehlen krankhafter Störungen verstandene Gesundheit als Ziel der Forschung gefordert und den Ausdruck „sturmfeste Gesundheit“ (buoyant health) geprägt. Eine Anzahl neuartiger Methoden und Ergebnisse sind in angesehensten Fachorganen erschienen. Aber das Zeitbewusstsein hat sie seltsamerweise nicht zur Kenntnis genommen, weder fortgeführt noch widerlegt. Sie passten anscheinend nicht ins Konzept und sind ungeprüft und unwiderlegt jeweils im „ Geheimarchiv der Gesundheitslehre“ verschwunden. Fachbücher und Enzyklopädien ingorieren sie und man stösst immer wieder auf Persönlichkeiten, die daran zwar aufs höchste interessiert sind oder sein müssen, die aber von diesen bahnbrechenden Arbeiten und Ergebnissen nichts, oder so gut wie nichts kennen. Diese Unkenntnis und Verdrängungstendenz hat seit den fünfziger Jahren sogar noch zugenommen.
Nun sind diese Arbeiten und Ergebnisse aber nicht wirklich verloren. Man muss nicht zusammensuchen aus der unübersehbaren Fachliteratur, sondern es gibt ein Organ, das sich seit langer Zeit speziell der Aufgabe gewidmet hat sie laufend weltweit zusammenzusuchen, soweit das immer möglich war, sie kritisch wägend und vergleichend zu sammeln und zu berichten: „ Der Wendepunkt“, stets eingedenk der Mahnung von André Gide: Zweifelt an jenen , die die Wahrheit haben, glaubt jenen, die sie suchen!“ Denn hier, wenn irgendwo, erhebt sich die Frage der Zuständigkeit. Wo es um Gesundheit in diesem Sinne, um Lebensqualität geht, werden ja alle Fachexperten zu Laien, ob es sich um körperliche, seelische, geistige oder soziale Gesundheit handle. Mit dem Anwachsen, der Wissensgebirge ins Ungeheure, Unübersehbare, der Informationsflut ins Unschluckbare, mit der Apparate- und der Wirtschaftsäbhängigkeit der Forschung und der immer grösseren Einenung des Wissens in Spezialistensparten, scheint es kaum mehr möglich geworden zu sein, die Zusammenhänge und Ganzeitsgestalten, die das Leben bietet, zu erfassen. Übrig bleibt nur einerseits höchste Achtung vor allen echten Forscherleistungen und anderseits ein Bekenntnis: Wir sind heute alle Laien, wenn es um Derartiges geht. Qualifizierung verlangt hier, bei grundsätzlicher Bescheidenheit und Offenheit, die Schärfung und Verfeinerung des Sinnes für die Hintergründe aller Informationen, soweit dies menschenmöglich ist, und den Versuch, gegensätzliche Tendenzen in ihrem Wesen und ihren Auswirkungen bis in ihre Extreme zu verfolgen und durchzudenken, um durch die dadurch gewonnene Weitung des Blickfeldes die fruchtbaren Ansatzpunkte und Suchrichtungen zu finden.

Nehmen wir als Beispiel die Zusammenhänge Ernährung und Gesundheit. Naturwissenschaftlich analytische und statistische Methoden bis hin zu Blindversuchen und zur Anwendung modernster Apparaturen und Methoden sind zweifellos von hohem Wert. Wichtiger aber noch ist, was vorausgeht: die Fragestellung, und das, was folgt, die Auswertung. Beides entzieht sich aber völlig der naturwissenschaftlichen Methodik. Fruchtbarste Fragestellungen ergeben sich zum Beispiel aus der Geographie und Geschichte der Ernährung; aber diese Gebiet ist der Fachwelt so gut wie unbekannt. Einschlägige Werke und Veröffentlichungen wertvoller Untersuchungen sind zwar in nicht geringer Zahl vorhanden, aber weder genügend kritisch gesichtet noch verwertet worden. Es gilt, sie aus dem „Geheimarchiv“ zu ziehen und weiterem Forschen zugrunde zu legen. Und sowohl bei der Fragestellungen wie bei den Auswertungen spielt auch die wirtschaftliche Lage eine oft entscheidende Rolle, die es zu erkennen zu beachten gilt. Um sich davon Rechenschaft zu geben, braucht man nur die Fachliteratur der Not-Und Rationierungszeiten und jene der Überflusszeiten zu vergleichen. Insbesondere aber ist zu bedenken, dass nicht nur grösste naturwissenschaftliche Genauigkeit, sondern auch kritische Fragestellung und kluge Auswertung erst dann ihren vollen Wert gewinnen können, wenn zuvor der Begriff „Gesundheit“ geklärt ist, insofern die echte, die positive, die sturmfeste Gesundheit in ihrem Wesen und ihren Entstehungsmöglichkeiten erkannt worden ist.

In diesem Sinne ist, wie erwähnt, im „ Wendepunkt“ alle fortlaufend auf den Fachliteraturen gesammelt und kritisch sichtend zu berichten gesucht worden, insbesondere seit Mitte der dreissiger Jahre, als das Interesse dafür angesichts der Wirtschaftslage in der Fachwelt einem Höhepunkt entgegenging, aber auch in allen folgenden Jahrzehnten und insbesondere seit der neuen Wendung im Zeitgeist der letzten 10-20 Jahre. Ich widmete alle verfügbare Zeit dieser Aufgabe in Verbindung mit Ärzten und Fachleuten verschiedener Gebiete. Da die Ergebnisse dieser Arbeit aber in vielen Jahrgängen enthalten und somit nicht leicht zugänglich und auffindbar sind, werden sie hier, soweit von zeitloser Bedeutung und von Zukunftswert, in einer Reihe handlicher kleiner Bände geordnet zur Verfügung gestellt.

Dr. Ralph Bircher

Inhaltsverzeichnis:

  • Vorbemerkung
  • „Der Arzt ist nun im Begriff“
  • „Es gibt keine Alterskrankheiten“
  • „Verschafft uns eine Ernährungswissenschaft!“
  • „Ursachen unbekannt“
  • Der Grosse Fastenmarsch
  • „Wandelnde Leguminosen“
  • „Eine Gute Speise, Fast wie Fleisch“
  • Wieviel Nahrung braucht der Mensch?
  • Die Rohkostforschungen von Eppinger und Kaunitz
  • Längst Fällige Neuprüfung der Naturheilkunde
  • Die Verdauungs-Leukozytose
  • Die Tarahumara
  • Vollgesundheit bei „ Hungerkost“
  • Grösste Lebensleistung mit geringster Nahrungsmenge
  • Knappe Kost-Langes Leben
  • Grösster Milchertrag bei Knappster Fütterung!
  • Prof. Eimers Rohkost-Sportstudenten
  • Hindhede
  • Das Chittenden-Experiment
  • Die Ergebnisse von Osaka
  • Goms
  • Vorkriegs-China
  • Die Bantu-Untersuchung
  • Die Java-Untersuchungen
  • Mexiko-„Dreierlei Hunger“
  • Wie die Wikinger sich Ernährten
  • Eskimoernährung und- Gesundheit
  • Jersey
  • Portonico
  • Der Eiweissminimum-Versuch Rhyn-Abelin
  • Sachregister

Zu wenig bekannte Belege, die jeder kennen sollte, dem es um die Gesundheit geht.

Ein hilfreiche, sonst nirgends zu findende, Fülle von zu wenig bekannten Forschungsergebnissen und prominenten Erklärungen zur Frage, wie sturmfest Gesundheit und Aufschwung der Selbstheilkräfte zu gewinnen sind, knapp, klar und verständlich vorgebracht und rasch nachschlagbar.