Edition Bircher-Benner

Unsere Handbücher in der Übersicht


Bircher-Benner Handbuch Nr. 1 Handbuch für Multiple-Sklerose-Kranke, Morbus Parkinson und andere neurodegenerative Leiden

Damit die Ursachen der multiplen Sklerose und anderer neurodegenerativer Krankheiten, soweit sie bis heute bekannt sind, verstanden werden können, ist es wichtig, einige Grundkenntnisse über den Bau und die Funktion des zentralen Nervensystems zu vermitteln. Die multiple Sklerose kann grundsätzlich an jedem Ort das zentrale Nervensystem angreifen und Schaden anrichten, so dass ihre Erscheinungsformen sehr vielfältig sind. Die Parkinsonsche Krankheit verläuft dagegen viel einheitlicher, da hier immer der Nukleus niger, ein pigmentierter Kern der Stammganglien des Gehirns im Zentrum der Zerstörung durch α-Synuclein steht und degeneriert, bevor die Demenz sich bemerkbar macht. Auch die amyotrophische Lateralsklerose zeigt einen typischen Verlauf, denn sie befällt fast ausschliesslich die motorischen Nervenbahnen, welche Kraft und Aktion der Muskulatur bewirken, so dass sie aufsteigende Lähmungen erzeugt. Die Vaskuläre Demenz zeigt ein unterschiedliches Bild und ist in der Regel mit Lähmungen verbunden, die dem Ort der erfolgten Gefässverschlüsse oder Einblutungen entsprechen. Die Alzheimerdemenz entsteht grundsätzlich im ganzen Gehirn, wobei aber anfangs ganz besonders der Hippocampus und das limbische System betroffen sind, welche für das Gedächtnis besonders wichtig sind. Besonders rasch und tragisch verläuft die Multisystematrophie (MSA). Auch bei ihr ergreift das degenerative Geschehen das ganze Gehirn

Erklärungen zu einigen anatomischen und funktionellen Begebenheiten des zentralen Nervensystems führen uns an die Ursachen dieser Krankheiten heran und ermöglichen dadurch jedem verständigen Patienten und seinen Angehörigen, aktiv an deren Verhütung und an der Heilung, soweit dies noch möglich ist, mitzuwirken; ein Weg, der sich lohnt.

Inhalt

  • Vorwort…7
  • Einleitung…10
  • Der Aufbau des zentralen Nervensystems…11
  • Das Grosshirn…11
  • Der Thalamuskern…12
  • Das Kleinhirn (Cerebellum)…13
  • Das limbisches System…13
  • Die Hormonbildenden Drüsen des Gehirns…14
  • Der Hypophysenvorderlappen (Adenohypophyse)…14
  • Der Hypophysenhinterlappen (Neurohypophyse)…15
  • Die Zirbeldrüse (Epiphyse) und das Melatonin…15
  • Die Nervenzelle (Neuron)…16
  • Das Aktionspotential…17
  • Die Synapsen…18
  • Botenstoffe des Nervensystems (Neurotransmitter)…18
  • Die Bedeutung der Gliazellen im Gehirn…19
  • Die Hohlräume des Gehirns und die Flüssigkeit in Gehirn und Rückenmark…21
  • Die Blut-Hirnschranke…22
  • Der Transport durch die Blut-Hirnschranke…24
  • Das Verhalten der Blut-Hirnschranke beim Stofftransport in und aus dem Gehirn…25
  • Die Wirkung des Alkoholkonsums auf die Blut-Hirnschranke…26
  • Die Wirkung des Rauchens auf die Blut-Hirnschranke…27
  • Die Wirkung elektromagnetischer Strahlung auf das menschliche Gehirn und die Blut-Hirnschranke…28
  • Die Myelin-Markscheiden, eine empfindliche Substanz…29
  • Demyelinisierende Erkrankungen…30
  • Remyelinisation…31
  • Das Guillain-Barré-Syndrom (GBS)…32
  • Krankheiten durch die Einlagerung von degenerativen Eiweissen…33
  • Die TAU-Proteine…33
  • Die Amyloidose…34
  • Die Wirkung der Ernährung auf das zentrale Nervensystem…35
  • Zweierlei Nahrungsenergie…35
  • Das Grundregulationssystem des zarten Bindegewebes im zentralen
  • Nervensystem… 37
  • Oxydativer Stress im Zentrum der Ursachen der neurodegenerativen Krankheiten.39
  • Der Einfluss der Umweltbelastung durch Schadstoffen als Ursache für die neurogenerativen Krankheiten…41
  • Die neurotoxische Wirkung des Quecksilbers…41
  • Organische Zinnverbindungen und Neurodegeneration…42
  • Chlor und neurodegenerative Krankheiten…43
  • Die neurotoxische Wirkung flüchtiger organischer Kohlenwasserstoffe…44
  • Insektizide und neurodegenerative Krankheiten…44
  • Holzschutzmittel und neurodegenerative Krankheiten…46
  • Neurotoxische Medikamente und Neurodegeneration…46
  • Legale und verbotene Drogen und neurodegenerative Krankheiten…47
  • Cannabis…47
  • Amphetamine …47
  • LSD (Lysergsäure-Diethylamid)…48
  • Heroin, Morphium, andere Opiate…48
  • Nikotin…48
  • Alkohol…49
  • Coffein…50
  • Zum Phänomen der Primär- und Sekundärwirkungen und der Gefahr medikamentöser Polypragmasie…52
  • Die Kombinationswirkung neurotoxischer Schadstoffe…52
  • Vitamine, Spurenelemente und neurodegenerative Krankheiten…53
  • Der Formenkreis der neurodegenerativen Krankheiten…55
  • Systematik der neurodegenerativen Krankheiten…55
  • Die Multiple Sklerose…57
  • Die Ursachen der Multiplen Sklerose…60
  • Die Vererbung…60
  • Die Infektionshypothese…60
  • Vitamin D und MS…61
  • Die Quecksilberbelastung und die Multiple Sklerose…62
  • Wissenschaftliche Grundlagen zur Ernährungstherapie bei Multipler Sklerose…64
  • Verlaufsformen der Multiplen Sklerose…69
  • Die Symptomatik der Multiplen Sklerose…71
  • Die Diagnose der Multiplen Sklerose…71
  • Die medikamentöse Therapie der Multiplen Sklerose…72
  • Die Ordnungstherapie der Multiplen Sklerose…75
  • Hilfsmassnahmen in der Krankenpflege, die Wasseranwendungen…78
  • Die Hydrotherapie für MS-Kranke Menschen…78
  • Die Darmentleerung…82
  • Zur allgemeinen Lebensführung bei Multipler Sklerose…84
  • Die Parkinsonsche Krankheit…86
  • Die Ursachen der Parkinsonschen Krankheit…87
  • Die Ernährung und die Parkinsonkrankheit…88
  • Die Symptome der Parkinsonkrankheit…90
  • Die Seelischen Auswirkungen des Parkinsonssyndroms…91
  • Die Sicherung der Diagnose der Parkinsonkrankheit…91
  • Atypische Parkinsonsyndrome…91
  • Die Therapie der Parkinsonschen Krankheit…92
  • Eine umfassende Therapie der Parkinsonkrankheiten…93
  • Die diätetische Therapie der neurodegenerativen Krankheiten…95
  • Empfehlungen für die Laborkontrollen für den behandelnden Arzt während der Diät98
  • Die praktische Anwendung der Rohkost-Therapie…102
  • Speisezettel…103
  • Menü-Zusammenstellungen bei verschiedenen Rohkost-Diätformen…103
  • Tagesmenü…105
  • Rezepte…107
  • Säfte…107
  • Birchermüesli…108
  • Früchte-Frischkorn-Speisen…110
  • Kaltschalen…110
  • Milcharten…111
  • Rohgemüse und Salate…111
  • Salatsaucen…112
  • Vorschläge für passende Saucen zu Salaten und Rohgemüse…115
  • Gekochte Speisen…116
  • Rezepte für gekochte Speisen…116
  • Gemüse…119
  • Salate von gekochten Gemüsen…124
  • Kartoffelgerichte…125
  • Getreidespeisen…126
  • Saucen…129
  • Belegte Brötchen…131
  • Rezeptverzeichnis…133
  • Literaturnachweis…137
  • Stichwortverzeichnis…149

Handbuch für Multiple-Sklerose-Kranke, Morbus Parkinson und andere neurodegenerative Leiden: Diesem Handbuch liegt das Wissen und die jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Bircher-Benner Handbuch 2 für Leber- und Gallenkranke

Umfassende Anleitung zur Pflege und Diät. Speisepläne und Rezepte aus einem Zentrum modernster Heilkunst des medizinischen Zentrums Bircher-Benner.

In den letzten Jahrzehnten hat die Zahl der Menschen, die an Leberkrankheiten oder deren Folgen leiden oder sich einer “empfindlichen Leber“ bewusst sind, stark zugenommen. (Li et al.)

Nur zum Teil ist dies die Folge epidemischer Leberentzündungen (Hepatitis) die nach scheinbarer Heilung oft einen dauernden Zustand von Überempfindlichkeit auf gewisse Nahrungsmittel, Blähungen und eine allgemeine Verminderung der Kräfte hinterlassen haben. Hinzu kommen jedoch die allgemein verbreiteten Ernährungsschäden, Alkohol, Arzneigifte und die sitzende Lebensweise mit mangelnder Durchblutung der Leber infolge zu flacher Atmung und ungenügender Körperbewegung sowie die nervöse Dauerspannung unserer Zeit, welche die Leber in ihrer Funktion belasten und die Wiederherstellung nach Schädigungen ganz bedeutend erschweren.

Der Leberkranke ist sich dessen bewusst, dass sich die Funktion der Leber in deren Anpassungsfähigkeit an die Nahrung widerspiegelt. Er weiss, dass Diätfehler unmittelbare Folgen haben. Die Folgen sind nicht nur örtliche Beschwerden in der Lebergegend, wie Blähungen, langsame Verdauung, Aufstossen, Spannungs- und Schweregehfühl, sondern auch eine empfindliche Störung des allgemeinen Lebensgefühls, der Lebensfrische und Leistungsfähigkeit, der Stimmung und des Erlebens der Beziehung zu anderen Menschen, Man fühlt sich nach einem Rückfall gedrückt, reizbar oder wehrlos, zieht sich in sich selbst zurück, oder man verletzt unbeabsichtigt andere Menschen und ist unfähig, etwas zu unternehmen.

Der Leberkranke beobachtet im allgemeinen, welche Speisen er meiden muss, er schont seine Leber so gut er kann. Nicht immer sind aber seine Schlussfolgerungen, seine Kenntnisse des Baus und der Funktion der Leber und sein Wille gut genug, um ihm zu erlauben, bedeutende Fehler der Lebensweise zu vermeiden, welche die Heilung seiner Leber-Gallenkrankheit verhindern.

Diesem kleinen Buch liegen nicht nur die neusten wissenschaftlichen Erkenntnisse zugrunde, sondern auch die über hundertjährigen praktisch-klinischen Erfahrungen der Bircher-Benner-Klinik. Dem Leser und der Leserin soll es alle Kenntnisse vermitteln, die sie nötig haben, um ihren eigenen Beitrag zur Heilung zu leisten.

Im diätetischen Teil finden sich Gerichte und praktische Speisezettel. Sie wurden in enger Zusammenarbeit der Diätküche mit den Ärzten der Bircher-Benner Klinik ausgearbeitet.

Die Rezepte überzeugen durch Geschmacks- und Abwechslungsreichtum. Die Leber-Gallendiät gereicht dem Kranken so zur Freude, dass er sie nicht als Einschränkung, sondern als eine Entdeckungsreise in eine neue Welt erfährt, eine gesunde, wohltuenden neue Art zu leben und sich zu ernähren.

Inhalte:

  • Vorwort zur 32. Auflage5
  • Einleitung7
  • Der Bau und die Funktion der Leber8
  • Der enterohepatische Kreislauf als Teufelskreis11
  • Die Aufgabe der Leber13
  • Wissensschaftliche Grundlagen der Ordnungstherapie
  • der Leber-Gallenkrankheiten...17
  • Die verschiedenen Krankheitsformen des Leber-Gallen-
  • symstems
  • Das allgemeine Erscheinungsbild der versagenden
  • Leberfunktion..23
  • Die Leberentzündung (Hepatits)25
  • Die Leberzirrhose (Schrumpfleber)28
  • Tumorerkrankungen der Leber..29
  • Gallensteine..30
  • Die Gallenblasenentzündung..31
  • Das Gallenblasenkarzinom.32
  • Die Gallengangsteine (Choledocholithiasis)..32
  • Das Postcholezystektomiesyndrom.33
  • Die Behandlung der Leber-Gallenkrankheiten
  • Pflanzliche Heilmittel (Phytotherapie, Spagyrik).34
  • Die Behandlung von Infektionen35
  • Die Hydrotherapie37
  • Die homöopathische Therapie, miasmatisch vererbte Folge
  • von Krankheiten und Traumen..45
  • Die neue wissenschaftliche Akupunktur.47
  • Die Neuraltherapie nach Huneke..48
  • Operative Verfahren50
  • Der Heilplan
  • Die Heildiät51
  • Die Behandlungder Hepatitis..53
  • Die Behandlung der Leberzirrhose..54
  • Die Behandlung der Gallenblasenentzündung54
  • Zur Vorbeugung und zur Vermeidung von Rückfällen54
  • Die vier Diätstufen
  • Die Diätstufe 1.58
  • Die Diästufe 2..60
  • Die Diätstufe 3.62
  • Die Diätstufe 4.64
  • Kleine Austauschtabelle für tierische Produkte, die bei
  • Diätstufe 3 weggelassen werden müssen..65
  • Die Rezepte
  • Säfte68
  • Gesundheits-Tees.70
  • Müesli..72
  • Rohgemüse und Salate..74
  • Salatsaucen..76
  • Milcharten.79
  • Butter, Pflanzenfette und Öle..80
  • Schonendes Kochen und Dämpfen.80
  • Suppen..81
  • Gemüse.85
  • Salat von gekochten Gemüsen91
  • Kartoffelgerichte.93
  • Getreidespeisen..96
  • Saucen..100
  • Belegte Brötchen102
  • Desserts..103
  • Rezeptverzeichnis107
  • Literaturverzeichnis..110
  • Stichwortverzeichnis..116

Handbuch für Leber-und Gallenkranke:
Diesem Handbuch liegt das Wissen und die jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Handbuch Nr. 4 für Frischsäfte, Rohkost und Früchtspeisen

Über neueste biophysikalische-wissenschaftliche Erkenntnisse zur Lebensenergie, Nahrunsenergie, Wirkung der lebendigen, vegetarischen Frischkost.

Viele Diätformen kommen eine Zeitlang auf, um dann wieder zu verschwinden. Die vitale vegetabile Frischkostdiät die Sie in diesem Handbuch kennen lernen werden, basiert dagegen auf solider wissenschaftliche Grundlage, die sich in den letzten 100 Jahren nur bestätigt und vertieft hat.
Am Ende des 19. Jahrhunderts entdeckte Dr.med. Maximilian Bircher-Benner, entgegen all seinen Erwartungen, fast zufällig die hohe Wirksamkeit ganz frisch zubereiteter, lebendiger Vegetabilien, wenn es um die Verhütung und Heilung der heute immer häufiger und immer früher auftretenden chronischen Krankheiten geht. Nach mehreren Jahren klinischer Erforschung, erkannte er, dass die lebendigen Vegetabilien eine ganz andere Nahrungsenergie enthalten müssen als die Verbrennungswärme (Kalorien). Bereits 1905 veröffentlichte er in Berlin seine erste, viel beachtete Ernährungslehre , nachdem er erkannt hatte, dass die Kalorien, das Mass der Wärmeenergie, die durch Verbrennung der Nahrungsmittel bestimmt wurde, zum Verständnis der Nahrungsenergie nicht ausreichen.
Die erstaunliche, heilende Wirkung seiner Diät erklärte er auf Grund seiner wissenschaftlicher Nachforschungen über mehrere Jahre mit dem zweiten Hauptsatz der Thermodynamik, dem Entropiegesetz . In der Tat ist es erstaunlich, dass unsere moderne medizinische Wissenschaft auch heute noch immer als einziges Mass für die Nahrungsenergie die Kalorien, die Verbrennungswärme kennt, während der zweite Hauptsatz der Thermodynamik auf allen anderen wissenschaftlichen Gebieten, in der Technik, der Physik und der Chemie seit 150 Jahren zur Basis aller energetischen Betrachtungen geworden ist.

Am Anfang des 20 Jahrhunderts, beherrschte die Furcht vor Ansteckung durch Bakterien die medizinische Welt, so dass man glaubte, es sei besser, alle Nahrung vor dem Verzehr zu kochen. Daraus ergaben sich neue Forderungen hygienischer Zubereitung der Rohkost. Als dann hitzelabile Vitamine und Vitalstoffe entdeckt wurden, bahnte sich Bircher-Benners Rohkostdiät ihren Weg zu weltweiter Anerkennung.

Die Erforschung der LASER-Amplifikation der Photonen in der Erbsubstanz der lebendigen Zellen ,5,6, und der Informationsleitung und -speicherung in der Grundsubstanz des Bindegewebes bestätigen Bircher-Benners Hypothese der Lichtakkumulation in lebendigen Nahrungsmitteln und der enormen Bedeutung der Photosynthese für den Energiewert der Nahrungsmittel als ordnende und damit heilende Information.

Eine weitere Bestätigung aus der Grundlagenforschung brachten unter anderem die Arbeiten des Nobelpreisträgers Ilya Prigogine über das dissipative System der lebenden Zellen, welche zeigten, dass das Streben aller physikalischen Vorgänge nach Unordnung (Entropiegesetz) in den lebendigen Zellen nicht gilt, da sie durch die Speicherung der Photonen aus der Photosynthese und die enorme rhythmische Verstärkung dieses Lichtes in den Zellen nach dem LASER-Prinzip in ihrer Energie so weit vom thermodynamischen Gleichgewicht entfernt werden, dass der zweite Hauptsatz der Energetik nicht gilt und das Chaosprinzip in ein ordnendes Kohärenzprinzip umschlägt.
In der Tat sind alle lebendigen Zellen der Natur der einzige Ort, wo aus kleinen, einfachen Molekülen komplexe, hochgeordnete Moleküle, Abläufe und Strukturen entstehen: wo aus Chaos Ordnung wird. Dies ist die grosse Bedeutung der Rohkostdiät, als einzige Diät, welche das ordnende Prinzip und die Ordnende Wirkung der lebendigen Zellen auf unser biologisches System überträgt und damit ihre grosse ordnende Heilwirkung entfaltet.

Hinzu kommt die hohe Nahrungsökonomie der lebendigen Pflanzennahrung, in welcher alle Nahrungsstoffe in geeigneten Mengenverhältnissen organisch gebunden und dadurch biologisch in höchstem Masse verfügbar werden, und wo die für die Assimilation der Vitalstoffe notwendigen Enzyme zugleich mitgeliefert sind, ihr hoher Gehalt an Polyphenolen, Carotinen und anderen Antioxidantien mit ihrer grossen, vor Degeneration und vor Genmutationen und damit vor Krebs schützenden Wirkung.
Alldem zu Folge ist nach unserer Erfahrung ein Gehalt unserer Nahrung an Rohkost von mindestens 70% am Beginn jeder Mahlzeit für die Erhaltung der Gesundheit notwendig.

Die reine Rohkostdiät ist in der Hand des Sachkundigen die ideale Heildiät zur Verhütung und Heilung aller degenerativen Krankheiten, die in unserer Zeit als „Zivilisationskrankheiten“ in ständiger Zunahme begriffen sind, ein Weg, der sich lohnt.

  • Einleitung 5
  • Zweierlei Nahrungsenergie7
  • Die neue Ordnung der Nahrungsmittel nach ihrem qualitiven Nährwert 9
  • Das Grundsystem des zarten Bindegewebes, Ursprung der Entstehung chronischer Krankheiten 11
  • Das Experiment im Royal Free Hospital in London 15
  • Einige weitere ausgewählte Beispiele wissenschaftlicher Untersuchungen zur Wirkung der Rohkosttherapie 19
  • Sekundäre Pflanzenstoffe, Arzneiwirkung pflanzlicher Nahrungsmittel 21
  • Zur Rohkosttherapie bei Gefahr von Thrombose und Embolie 26
  • Besonderheiten der Rohkosttherapie gegen Bluthochdruck 26
  • Besonderheiten der Rohkosttherapie zur Senkung des Cholesterinsspiegels 27
  • Zur Rohkosttherapie bei Diabetes mellitus 27
  • Zur Rohkosttherapie bei Infektionskrankheiten antimikrobielle Wirkung) 29
  • Zur Rohkosttherapie bei Immunschwäche und Infekt
  • anfälligkeit 29
  • Die Indikation zur Diät mit vegetabiler Frischkost
  • (Rohkost) 30
  • Die Diätstufe 1 32
  • Die Diätstufe 2 34
  • Formen vegetabiler Frischkost 35
  • Reaktionen auf die Umstellung auf die vegetabilen
  • Frischkostdiät und ihre Behandlung 37
  • Begleitende, allgemeine Empfehlungen zur vegetabilen
  • Frischsaftdiät 40
  • Die neue Gleichgewichtslage 41
  • Die verjüngende Wirkung der vitalen vegetabilen
  • Frischkost 44
  • Die richtige Anfangsdosierung 45
  • Das Thema der sogenannten "Rohkostintoleranz" 47
  • Die Zubereitung und Reinigung der Rohkost 47
  • Die Zusammenstellung der Rohkost 48
  • Die Anpassung an Geschmack und Kaufähigkeit 48
  • Die Reinigung der Rohkost 49
  • Von der Bircher-Raffel zur elektrischen Küchenmaschine 50
  • Speisezettel 51
  • Menü-Zusammenstellungen bei verschiedenen
  • Rohkost-Diätformen 51
  • Die Rezepte 55
  • Müesli 55
  • Früchte-Frischkorn-Speisen 57
  • Früchte-Speisen 57
  • Säfte 59
  • Schleim als Zusatz zu Säften 60
  • Milcharten 61
  • Saucen zu Rohgemüsen 62
  • Salatgerichte 62
  • Gesundheits-Tees 65
  • Stichwortverzeichnis 67
  • Literaturverzeichnis 68

Handbuch für Frischsäfte, Rohkost und Früchtespeisen.

Diesem Handbuch liegt das Wissen und die jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Bircher-Benner Handbuch 7 für Diabetiker

Diätanleitungen zur Verhütung und Therapie mit Rezeptteil, eingehende Ratschläge und ausgearbeiteter Kurplan aus einem ärztlichen Zentrum modernster Heilkunst.

Diesem Buch liegt ein grosses Erfahrungsgut zugrunde in der Behandlung von Menschen, die an Diabetes mellitus leiden.

Seit Dr. med. Maximilian Bircher-Benner vor über 100 Jahren die enorme Heilwirkung konsequenter Anwendung vegetabiler Frischkostdiät und geordneter Lebensweise entdeckt hat, sind an der Bircher-Benner-Klinik, heute medizinisches Zentrum Bircher-Benner, mehrere tausend Menschen geheilt worden, die an Diabetes des Typs II litten und deren Leben durch die Vielzahl der Folgekrankheiten und Komplikationen bedroht war.

In der ihr eigenen kommerziellen Geschäftigkeit stellt uns die pharmazeutische Industrie Medikamente und ausgeklügelte Injektionsapparate zur Selbstinjektion gentechnisch erzeugten Insulins bereit, die uns meistens erlauben, den Blutzuckerspiegel einigermassen zu kontrollieren.Dass aber die Diabetestherapie, so wie sie das derzeitige Paradigma der medizinischen Wissenschaft vorsieht, die Krankheit weder heilt, noch verhütet, ist aus der stetigen enormen Zunahme der Häufigkeit (Prävalenz) dieser Krankheit seit dem Ende des Zweiten Weltkrieges ersichtlich. Zwar sind die Ursachen des Diabetes mellitus und die Auswirkungen des „modernen“ Lebensstils und der Ernährung auf den Stoffwechsel und die Matrix des zarten Bindegewebes bereits gut erforscht, aber diese Erkenntnisse finden in der „modernen“ Diabetestherapie kaum Beachtung. Die medikamentöse Therapie geht nicht an die Ursache. Sie bekämpft nur das Symptom „Zuckerspiegel“.

Darum wird die Krankheit chronisch, tritt immer früher im Leben auf und wird immer häufiger. In den Industrie ländern betragen heute die Kosten für die Behandlung des Diabetes und seiner Folgen 20 % der gesamten „Gesundheitskosten“. In allen Gebieten westlicher Zivilisation ist der Diabetes eine eigentliche Volkskrankheit geworden. Deshalb spricht man auch von einer „ Epidemie des 20. Jahrhunderts“1. Im Jahr 1980 litten 153 Millionen Menschen an Diabetes mellitus2, 2013 waren es bereits 382 Millionen bzw. 8,3 % der Bevölkerung3. Prognostische Schätzungen mussten laufend nach oben korrigiert werden. Nur zu einem Drittel lässt sich diese Zunahme mit dem Älterwerden der Menschen erklären, das allerdings nicht durch eine verbesserte Gesundheit, sondern zu einem grossen Teil durch die verminderte Säuglingssterblichkeit und durch bessere Unfallverhütung zustande kam und nur zu einem kleineren Teil durch lebenserhaltende operative Eingriffe und Medikamente. Wohl können die schweren Folgekrankheiten mit der heute praktizierten pharmakologischen Therapie des Diabetes mellitus etwas hinausgezögert werden, aber die Krankheit schreitet dennoch stetig fort bis die schweren Folgen eintreten. Durch diese Tatsachen ist man gezwungen zu erkennen, dass die „moderne“ Diabetologie in ihrer Aufgabe,diese Krankheit zu verhüten und zu heilen, mindestens teilweise versagt hat.

Durch die allgemein verbreitete Fehlernährung werden die feinen Strukturen des zarten Bindegewebes mit den in ihr eingelagerten feinen Kapillaren durch Stoffwechselschlacken und Entzündung in der Zwischenzellsubstanz angegriffen, die molekularen Transportwege werden verlegt, so dass das Insulin seine Wirkung an den Rezeptoren der Zellmembranen allmählich verliert. Die Zellen werden gegen Insulin resistent, bei vermehrter Insulinproduktion. Lange können die Inselzellen der Bauchspeicheldrüse dies kompensieren, bis sie sich erschöpfen und zugrunde gehen. Die feinen Strukturen der Zellen und Interzellularräume und die Gefässwände werden nach und nach zerstört. Auch die Zwischenzellsubstanz der Leber füllt sich mit Stoffwechselschlacken. Dadurch gelangt das Cholesterin nicht mehr gut an die Leberzellen heran, so dass diese falsch tiefe Cholesterinwerte messen und die Cholesterinproduktion steigern. Die Störung des Zuckerstoffwechsels führt zu Bluthochdruck und Arteriosklerose. Es drohen Herz- und Hirninfarkte und ein Absterben von Gliedmassen durch Verschlüsse in den Beinarterien. Auch die feinen Strukturen der Augen werden angegriffen, bis zur Erblindung durch Glaukom, Retinopathie und Makuladegeneration. Auch die feinen Strukturen der Nervenscheiden erkranken, es kommt zu Empfindungsstörungen und Lähmungen ( diabetische Neuropathie).

Durch die Einlagerung degenerativer Eiweisse ( Amyloide) verdicken sich die Kapillarschlingen der Nieren, bis diese versagen ( diabetische Nephropathie). Gefässverschlüsse und Einlagerung von degenerativen Eiweissen (Amyloiden) in die Zwischenzellsubstanz des Gehirns gefährden Diabeteskranke frühzeitig für Demenz und die Alzheimerkrankheit.

Diabetes ist nicht eine eigenständige Krankheit. Er reiht sich ein in den gesamten degenerativen Prozess der Zivilisationskrankheiten. Nur in seltensten Fällen entsteht er als Teil einer unheilbaren Krankheit. In aller Regel ist der Diabetes mellitus des weitaus häufigsten 2. Typs die Folge einer Ernährungs- und Lebensweise, die den natürlichen Gegebenheiten unseres biologischen Systems widerspricht. Beginnt man frühzeitig genug mit der diätetischen Therapie, so lässt sich der Diabetes mellitus des viel häufigeren Typs II zuverlässig verhüten und heilen, auch wenn eine familiäre Belastung vorhanden ist.

Die Erkenntnisse Bircher-Benners sind durch wissenschaftliche Untersuchungen ständig ergänzt und überprüft worden, wobei sie sich gerade in neuester Zeit laufend bestätigen.
Dieses Buch erklärt in sorgsamer und dennoch gut verständlicher Weise die Ursachen und das Wesen der Zuckerkrankheit und gibt dem Leser alles nötige Wissen in die Hand, das ihm ermöglicht, an der Heilung seiner Krankheit aktiv mitzuarbeiten. Wirkliche Heilung ist nicht möglich, ohne eine grundlegende Vertiefung des Bewusstseins über den Sinn des Lebens, über den Sinn der Erkrankung, über die Ordnungen des Lebens, über die Beziehung zur Arbeit, zur Gesellschaft, zu sich selbst und zu den Menschen, mit denen wir leben. Am Anfang dieses Weges zur Heilung steht eine grosse Frage der Verantwortung den Mitmenschen und sich selbst gegenüber, sie wird zur Basis auf dem Weg zur Heilung des Diabetes mellitus, ein Weg, der sich lohnt. Für den behandelnden Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung und Begleitung seines Patienten.

Inhalt:

  • Vorwort
  • Das Wesen der Zuckerkrankheit (Diabetes mellitus)
  • Die Warnzeichen des Diabetes mellitus
  • Der Blutzuckerspiegel
  • Der Normwert des Blutzuckerspiegels
  • Die Messung des Blutzuckerspiegels
  • Der Glukosetoleranztest (oGTT)
  • Die Regulation des Blutzuckerspiegels
  • Die Korrektur eines zu hohen Glukosespiegels im Blut
  • Die Glukoseverwertung in den Mitochondrien der Zellen
  • Die Korrektur zu tiefer Blutzuckerspiegel
  • Die Wirkung von Stress auf den Blutzuckerspiegel
  • Die Zuckerausscheidung im Urin
  • Die Ausscheidung von Ketonkörpern im Urin
  • Die verschiedenen Arten von Diabetes mellitus
  • Der Diabetes mellitus des Typs 1
  • Die Ursachen des Diabetes Typ 1
  • Das Geschehen bei Diabetes des Typs 1
  • Die klinischen Symptome des Diabetes des Typs 1
  • Der Diabetes mellitus des Typs 2
  • Allgemein anerkannte Teilursachen des Typ-2-Diabetes
  • Genetische Risikofaktoren für eine Typ-2-Diabetes
  • Weitere Teilursachen, die in der Lebensweise liegen
  • Krankheit, Wundheilung, körperlicher Stress und Bewegungsmangel
  • Zuckerstoffwechsel und Arteriosklerose
  • Glykämischer Index und glykämische Ladung
  • Der glykämische Index (glycemic index GI)
  • Die glykämische Ladung (glycemic load,GL)
  • Die Folgekrankheiten des Diabetes mellitus
  • Die Körperlichen Schäden durch Zucker
  • Die exogene Glykation
  • Die endogene Glykation
  • Die endotheliale Dysfunktion und die Arteriosklerose
  • Die Spätfolgen des Diabetes mellitus im Herz-Kreislaufsystem
  • Bluthochdruck und Diabetes
  • Diabetes und Arteriosklerose
  • Das diabetische Fusssyndrom
  • Oydativer Stress im Zentrum der Ursachen neurodegenerativer Krankheiten und Demenz
  • Die diabetische Polyneuropathie
  • Die diabetische Retinopathie
  • Die diabetische Makulopathie
  • Konventionelle Therapien der Retinopathie
  • Operative Therapien bei diabetischer Retinopathie
  • Die diabetische Nephropathie
  • Allgemeine anerkannte Risikofaktoren für eine diabetische Nephropathie
  • Die Stadien der diabetischen Nephropathie (nach Mogensen)
  • Der Schwangerschaftsdiabetes
  • Allgemein anerkannt sind folgende Risikofaktoren
  • Die Schwangerschaft bei diabetischer Nephropathie
  • Die medikamentöse Therapie des Diabetes mellitus
  • Die Insulintherapie
  • Insulinarten
  • Die Methoden der Insulininjektion
  • Formen der Insulintherapie
  • Das Therapieprotokoll
  • Die Insulintherapie bei Schichtarbeit oder unregelmässigem Tagesrhythmus
  • Unerklärbare Blutzuckerschwankungen
  • Zur Insulintherapie des Typ-2-Diabetes
  • Die basal unterstützte orale Therapie (BOT)
  • Die Therapie mit der Insulinpumpe
  • Das Basis-Bolusprinzip
  • Die Insulinpumpe mit Hybrid-Close-Loop-System
  • Das Einstellen der Insulinpumpe
  • Die Sensorunterstützte Pumpentherapie (SuP)
  • Die Therapie des Diabetes Typ 1 und die allgemein anerkannte Therapieziele
  • Die Therapie des Diabetes des Typs 2
  • Die Entwöhnung vom Rauchen als Bestandteil der Basistherapie des Diabetes mellitus
  • Diabetes und Alkohol
  • Kaffee und Diabetes mellitus
  • Diabetes und Alkohol
  • Kaffee und Diabetes mellitus
  • Die Therapie des Diabetes Typ 2 nach den Leitlinien der deutschen Gesellschaft für Diabetes
  • Tabelle zum Idealgewicht
  • Das Idealgewicht erwachsener Männer
  • Das Idealgewicht erwachsener Frauen
  • Das Problem der Nahrungsenergie
  • Diabetesmedikamente (Antidiabetika), Wirkung und Nebenwirkungen
  • Nichtinsulinotrope Antidiabetika
  • Insulinotrope Antidiabetika
  • Zur Insulintherapie beim Diabetes des Typs2
  • Die Hypoglykämie
  • Die Therapie der Hypoglykämie
  • Die Ordnungstherapie des Diabetes mellitus
  • Zweierlei Nahrungsenergie
  • Das Grundregulationssystem des zarten Bindegewebes
  • Die Bedeutung der Nahrungsökonomie
  • Das Integralgesetz der Nahrung
  • Die Lebendigkeit der Nahrung
  • Sekundäre Pflanzenstoffe (Phytochemicals) mit antidiabetischer Wirkung
  • Der Mineralstoffwechsel beim Diabetes mellitus
  • Die Heilpflanzen für die Diabetestherapie
  • Die Bedeutung der Bewegung
  • Allgemeine Richtlinien zur Ordnungstherapie der Zuckerkrankheit
  • Zur Diät
  • Die Nahrungsmenge
  • Die Grundsätze der Bircher-Benner Diät und Ordnungstherapie für Diabetiker
  • Lebensordnung und Körpertraining
  • Die Hygiene
  • Wasseranwendungen, Anregung des Kreislaufs, Luft, Licht und Sonne
  • Die seelische Betreuung
  • Kurzzusammenfassung
  • 11 Grundregeln
  •  
  • DIE BIRCHER-BENNER DIABETESDIÄT
  • Allgemeines
  • DIÄT-REZEPTE FÜR DIABETIKER
  • Allgemeine Angaben
  • Broteinheiten und ihre Berechnung
  • Die Kohlenhydrateinheit
  • Zucker in der Diät
  • Rezeptteil
  • Rezepte für die vegetabile Frischkost (Rohkost)
  • Das Birchermüesli
  • Rohgemüse und Salate
  • Saucen zu Rohgemüsen und Salaten
  • Sauerkraut
  • Frischgetreide,
  • Frischsäfte
  • Pflanzen-Milch-Arten
  • Warme Speisen
  • Butter, Reform- Pflanzenfette und Öle
  • Suppen
  • Suppen-Einlagen
  • Gemüse
  • Salate von gekochten Gemüsen
  • Belegte Brötchen
  • Kartoffelgerichte
  • Getreidespeisen
  • Reisgerichte
  • Andere Getreidegerichte
  • Saucen
  • Süssspeisen
  • Tees
  • Anhang und Tabellen zur Diabetesdiät
  • Frischsäftetag
  • MENÜS für verschiedene Jahreszeiten
  • Anmerkung zur Menü-Gestaltung
  • Menüs im Winter
  • Menüs im Frühjahr
  • Menüs im Sommer
  • Menüs im Herbst
  • Berechnete Tagesmenüs für die Diabetesdiät (1200-2100K)
  • Tabelle zum glykämischen Index und der glykämischen Ladung
  • Rezeptverzeichnis
  • Literaturnachweis
  • Stichwortverzeichnis

Handbuch für Diabetiker

Diesem Buch liegt das Wissen und die jahrzentelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Bircher-Benner Handbuch Nr. 9 Essensfreude ohne Kochsalz

Das Kochsalz war seit jeher eines der beliebtesten Genussmittel der Menschen. Im Keltisch-Germanischen Raum wurde schon in der Bronzezeit die Produktion von Meersalz gross angelegt. Die Sumerer nutzten Salze zum Konservieren von Lebensmitteln. Im alten Rom schätzten Plinius der Ältere und Lucius Columella den täglichen Salzverbrauch auf umgerechnet 25 g/Person. Damals und bis im19. Jahrhundert diente das Kochsalz vor allem als Konservierungsmittel für Fleisch, Kohl und Bohnen.

Kaum jemand ist sich des Schadens bewusst, welchen zu hohe Mengen an Kochsalz verursachen. Seit den 1970iger Jahren wird ein hoher Salzkonsum als eine der wichtigsten Ursachen hohen Blutdrucks und damit eines hohen Risikos für Herz-Kreislaufkrankheiten anerkannt. Der Kochsalzverbrauch in den USA wurde von der Food- and Drug Administration auf 8,4g/Person und Tag geschätzt, was ca. 2 ¼ Teelöffeln entspricht. Die US-Behörden haben Richtlinien zur Reduktion des Kochsalzes in allen Fertigprodukten erlassen, da diese 75% des Salzkonsums verursachen. Sie gehen davon aus, dass durch eine Reduktion von 40% in den nächsten zehn Jahren 500'000 Menschenleben gerettet werden könnten. Der tägliche Salzbedarf des Menschen ändert sich je nach klimatischem Umfeld und der Jahreszeit. Er wird heute mit 1,8 bis 6,4 g angegeben. Die Weltgesundheits-organisation empfiehlt derzeit 5 g pro Tag, was ca. 1,2 gestrichenen Teelöffeln entspricht. 

Viele Menschen unterschätzen ihren Salzkonsum, da er zu ¾ aus Fertigprodukten besteht und nur zu ca. ¼ aus dem Zusalzen. Beliebt sind gepökelte Fertigprodukte, wie Fisch-, Fleisch- und Wurstwaren. Pökelsalz ist Speisesalz mit Zugabe von 0,4 bis 0,5% Natriumnitrit. Durch das Nitrit erhält gepökeltes Fleisch eine appetitlichere, stabile rote Farbe, indem sich das Radikal Stickoxyd (NO) mit dem Myoglobin zu hitzestabilem Nitrosomyoglobin verbindet. Dadurch sind aber alle mit Nitrit gepökelte Produkte krebserzeugend.

Hinzu kommt der Natriumgehalt aus Natriumfluorid. Zur Kariesprophylaxe wird seit 2006 im ganzen EU-Raum dem Kochsalz Natriumfluorid zugegeben. Dieses wird in der Bevölkerung zu 80% verwendet. Der Zusatz von Gewürzen und anderen Geschmacksstoffen, wie zum Beispiel Glutamat, führt zu der umfangreichen Palette der Gewürzsalze. Zum einen sollen die Gewürze dem Salz mehr Geschmack geben, andrerseits wirkt der Salzzusatz stabilisierend auf die Gewürze.

Die Vorgänge, die zum Bluthochdruck führen, sind komplex. Es gibt genetische und Umwelteinflüsse.  Noch ist nicht klar, warum nicht alle Menschen auf hohe Kochsalzmengen gleich empfindlich reagieren. Bei rund 70% der Menschen entsteht schon bei relativ geringer Überdosierung Bluthochdruck, eine so genannte «Salz sensitive Hypertonie». Andere vertragen etwas mehr, doch wird auch bei ihnen das übermässige Salz in den Geweben gespeichert. Hohe Salzkonzentrationen hat aber auch bei jenen Menschen, bei denen sie nicht sofort Bluthochdruck erzeugen krankmachende Effekte auf das Gefässsystem, die vom Blutdruck unabhängig sind. Viel Kochsalz schädigt die Innenschicht der Blutgefässe, das Endothel und erzeugt Arteriosklerose.

Der versteckte Salzkonsum durch industrielle Fertigprodukte und Fast-food Angebote hat drastisch zugenommen. Damit einher geht die massive Zunahme der Hypertonie. 30% der Weltbevölkerung leiden heute an Bluthochdruck.  In den industrialisierten Staaten leidet mehr als jeder Zweite Erwachsene über 19 Jahren an Hypertonie und nimmt blutdrucksenkende Medikamente ein. Dem zu Folge hat der «normale Erwachsene» Hypertonie und ist es nicht mehr «normal», keinen zu hohen Blutdruck zu haben und keine antihypertensiven Medikamente einnehmen zu müssen.

Nicht das Kochsalz allein bewirkt den Bluthochdruck. Auch der hohe Konsum an Weissmehlprodukten und Zucker schädigt die Innenschicht der Gefässe durch direkte chemische Reaktion der Zucker mit dem Endothel. Diese innerste Schicht reguliert die anatomische Beschaffenheit und die Muskelspannung in der ganzen Gefässwand. Durch die Beschädigung durch dieses Übermass an Kochsalz und Zucker verliert das Endothel die Fähigkeit, die Muskelspannung der Blutgefässe und deren Aufbau und Fasergehalt zu regulieren. Man nennt dies endotheliale Dysfunktion. Die Gefässe werden eng und können bei erhöhtem Blutfluss nicht mehr weit gestellt werden, so dass der Blutdruck vorerst bei Anstrengung oder Aufregung ansteigt (labile Hypertonie). Dann verhärten sich die Gefässwände durch Einlagerung von hartem Bindegewebe (Kollagen). Dadurch bleibt der Blutdruck konstant erhöht, auch bei Entspannung und im Schlaf (fixierte Hypertonie). Nun lagern sich zunehmend Stoffwechselschlacken in die Zwischenzellsubstanz (Matrix) der Gefässwände ein, die Entzündungen bewirken und die Gefässwände zu arteriosklerotischen Plaques verdicken, bis diese Cholesterin und Kalk einlagern. Auf diese Weise erzeugt ein hoher Salz-, Weissmehl- und Zuckerkonsum schon in jungen Jahren die Arteriosklerose.

Geschieht dies in den Herzkranzgefässen, entsteht die Angina pectoris und der Herzinfarkt, geschieht dies in den Carotisarterien, die das Gehirn versorgen, so entsteht der Hirnschlag, die Apoplexie. Geschieht dies in Arterien der Beine, so entsteht die Schaufensterkrankheit (Claudicatio intermittens) durch Krämpfe und Schmerzen beim Gehen, da die durch Arteriosklerose verengten Beinarterien den Bedarf an Blut und Sauerstoff nicht mehr gewährleisten können.

Hoher Salz-, Weissmehl- und Zuckerkonsum schädigt die feinen Gefässe der Nieren und der Augen und bewirkt, dass das Kammerwasser der Augen nicht mehr durch die feinen Strukturen im Augenwinkel abfliessen kann, so dass sich der Druck in den Augen erhöht. So entsteht das Glaukom, die Erblindung durch den grünen Star und die Makuladegeneration.

All diese tragischen Krankheiten erscheinen wie ein schweres Schicksal. Eigentlich sind sie aber nicht einfach ein «Schicksal», denn sie können zuverlässig verhütet werden durch eine Ernährung mit lebendiger vegetabiler Vollwertkost mit hohem Rohkostanteil, mit Frischkräutern gewürzt, unter Verzicht auf alle Reizmittel, wie viel Kochsalz, Zucker, Kaffee und Alkohol. Durch kein Medikament können sie verhütet werden, sondern durch eine Ernährungs- und Lebensweise, die unseren biologischen Bedürfnissen entspricht.

Ist der Bluthochdruck bereits entstanden oder schon weitergehende Herz-Kreislaufkrankheiten, so ist eine salzarme Diät notwendig. Die in diesem Buch angegebenen Rezepte wurden in der berühmten Bircher-Benner Klinik entwickelt. Salzarme und salzlose Rezepte zu gestalten, welche nicht fade sind, sondern köstlich munden, ist eine hohe Kunst. Diesem Buch liegt ein grosses Erfahrungsgut zu Grunde in der Behandlung von Menschen, die an ernährungsbedingten Krankheiten leiden. Seit Dr. med. Maximilian Bircher-Benner vor über 100 Jahren die enorme Heilwirkung konsequenter Anwendung vegetabiler Frischkostdiät und geordneter Lebensweise entdeckt hat, sind an der Bircher-Benner Klinik, heute medizinisches Zentrum Bircher-Benner, mehrere tausend Menschen geheilt worden, die an den heute sich massiv ausbreitenden «Zivilisationskrankheiten» litten. Dieses Buch beschreibt einen der Bausteine einer Therapie, welche nicht bloss Symptome unterdrückt, sondern an die Ursachen der Krankheiten geht, um diese zu heilen. Die Rezepte sind bereit zur praktischen Anwendung. Dem Arzt bedeutet dieses Buch eine grosse Zeitersparnis bei der Beratung seiner Patienten.


Stöllner T.: Salz, Salzgewinnung, Salzhandel. 3. Archäologisches. In: Reallexikon der Germanischen Altertumskunde. 2. Auflage. Band 26,2004: 357-79.
Bass H.H.: Hungerkrisen in Preussen während der ersten Hälfte des 19. Jahrhunderts. Scripta Mercatureas, Verlag St. Katharinen 1991 ISBN: 3-922661-90-4 S. 12

Inhaltsverzeichnis

  • Vorwort
  • Die Blutdruckregulation in der Niere
  •      Das Renin-Angiotensin-Aldosteron System der Blutdruckregulation
  • Die Salzsensitive Hypertonie
  •      Die osmotisch wirksame Speicherung des Kochsalzes in den Geweben
  • Die osmotisch unwirksame Speicherung des Kochsalzes
  •      Die Wirkung salzarmer Kost auf den Blutdruck
  •      Epigenetische Vererbung der Salzsensitivität
  •      Die Auswirkung der Versalzung und Verzuckerung (Glykation) der Innenschicht der  
  •      Innenschicht der Blutgefässe
  •      Epitheliale Dysfunktion und Arteriosklerose
  • Oxydativer Stress im Zentrum der Ursachen degenerativer Krankheiten und Demenz
  • Das Problem der Nahrungsenergie
  • Die Ordnungstherapie der Hypertonie
  •      Zweierlei Nahrungsenergie
  •      Die Photonenspeicherung in den lebendigen Geweben
  •      Das Grundregulationssystem des zarten Bindegewebes
  •      Die Bedeutung der Nahrungsökonomie
  •      Das Integralgesetz der Nahrung
  •      Die Lebendigkeit der Nahrung
  • Die Grundsätze der Bircher-Benner Diät und Ordnungstherapie
  • Lebensordnung und Körpertraining
  • Speisepläne für die salzarme Kost, für Hypertonie- und Herzkranke
  •      Wochenplan für strenge salzlose, natriumarme Kost
  •      Speisezettel für 1 Woche salzlose Kost (milde From)
  • Rezepte für salzlose und salzarme Kost
  •      Säfte
  •      Birchermüesli
  •      Rohgemüse und Salate
  •      Salatsaucen
  •      Vorschläge für passende Saucen zu Salaten und Rohgemüse
  •      Milcharten
  •      Butter, Pflanzenfette und Öle,
  •      schonendes Kochen und Dämpfen
  •      Suppen
  •      Suppeneinlagen
  •      Gemüse
  •      Salate von gekochten Gemüsen
  •      Kartoffelgerichte
  •      Getreidespeisen
  •      Saucen
  •      Belegte Brötchen
  •      Desserts
  •      Gesundheitstees
  • Tabelle zum glykämischen Index und der glykämischen Ladung
  • Rezeptverzeichnis
  • Stichwortverzeichnis
  • Literaturnachweis

In den „zivilisierten“ Ländern leidet heute mehr als jeder zweite Erwachsene an Bluthochdruck. Dem zu Folge ist es nicht mehr normal, keine Hypertonie zu haben und keine Medikamente dagegen einzunehmen. Die Menschen konsumieren heute fünf- bis zehnmal mehr Kochsalz, als der Körper verträgt, oft ohne es zu merken, da enorme Mengen in industriellen Produkten vorhanden sind. Die täglichen hohen Kochsalzspiegel im Blut versalzen den Körper chemisch. Sie schädigen die Innenschicht der Blutgefässe, so dass sie sich verhärten und Bluthochdruck entsteht, die so genannte „salzsensitive Hypertonie“. Die Folge ist die Arteriosklerose mit ihren katastrophalen Folgen des Herzinfarkts und Hirnschlags. Die Hypertonie kann durch keine Medikamente geheilt werden. Sie kann aber zuverlässig verhütet und geheilt werden durch die Diät, welche in diesem Buch beschrieben ist. Gesalzene Speisen zu kochen ist ein Kinderspiel. Salzarm oder gar salzfrei zu Kochen, so dass das Essen grosse Freude bereitet, ist eine hohe Kunst. Die Salzrestriktion in der Nahrung ist eine Grundvoraussetzung für die Verhütung und Heilung der Hypertonie. Dieses Buch erklärt auf wissenschaftlicher Basis die Wirkungen des Kochsalzes in unserem Körper und enthält eine Fülle von Diätplänen und wunderbaren, köstlich mundenden Rezepten aus der berühmten Bircher-Benner Klinik. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Handbuch 10 für Rheuma und Arthritiskranke

Über das Wesen der Rheumakrankheit, Moderne rheumatische Forschung, Umfassende Anleitung, Zur Pflege und Diät, Speisepläne und Rezepte.

Dieses Handbuch beruht einerseits auf einem großen Erfahrungsgut von Kranken, die durch die Birchersche Ordnungstherapie Heilung fanden; andererseits wurden die früheren Auflagen durch viele wertvolle Hinweise aus der Grundlagenforschung und durch klinische Ergebnisse der rheumatologischen Forschung ergänzt. Auch der diätetische Teil wurde sanft überarbeitet, ohne daß die hohe Qualität der Bircherschen Rezeptkunst verloren ging. Das Handbuch gibt den Kranken und ihren Angehörigen das unentbehrliche Wissen und die dringend nötige praktische Anleitung in die Hand, die es erfahrungsgemäß ermöglichen, den Krankheitsprozeß aufzuhalten und stetige Heilungsschritte einzuleiten.

Dem ganzheitlich behandelnden Arzt kann das Buch eine wertvolle Hilfe sein, wenn es um die Anleitung seiner Patienten zur Umstellung ihrer Lebensweise, zur Ordnungstherapie geht.
Seit Dr. med. Max Oscar Bircher-Benner wurde während rund hundert Jahren an der Bircher-Benner Klinik selbst und in privaten Arztpraxen die Ordnungstherapie der rheumatischen Krankheiten in sorgsamer Beobachtung der Heilungswirkungen erforscht. In all diesen Jahren waren die vielen tausend Patienten, die aus ihrer zur Verzweiflung führenden Krankheitsentwicklung herausfanden, unsere größten Lehrmeister. Mit starkem Willen zur Heilung führten sie die Anweisungen der Ordnungstherapie erfolgreich aus und ermöglichten die großen Erkenntnisse, die jetzt allmählich auch in der allgemeinen medizinischen Forschung bestätigt werden.

In der Neuordnung der Lebensweise hat die Ernährung eine erstrangige Bedeutung. Sie führt zu einer Regeneration der großen Regulationssysteme, zu einer neuen Öffnung zur Außenwelt und zu sich selbst, die erst das Ingangkommen der Heilungskräfte des Organismus, des Körpers und der Seele möglich werden läßt. Zitiert sei hierzu bloß eine Stelle aus Bircher-Benners Schrift „Vom Werden des neuen Arztes“: „Die Wunder der Seele bleiben jenen verschlossen, die dauernd die Ernährungsgesetze missachten. Von der Ernährung hängen Kraft und Tiefe der inneren Erlebnisse ab – das ist ihre eigentliche Bedeutung. Sich um seinen Körper, um seine Ernährung zu kümmern, hat keinen Zweck, es sei denn, daß daraus eine neue Entfaltung, ein Erwachen innerer Kräfte entstehe.“

Dr. med. Andres A. Bircher

  • Vorwort7
  • Einleitung9
  • Was ist Rheuma? 9
  • Ursprung des Rheumas ist die Erkrankung des weichen Bindegewebes (Mesenchym).10
  • Die biochemische Struktur des weichen Bindegewebes12
  • Die Verknüpfung des weichen Bindegewebes mit dem Hormonsystem und dem vegetativen Nervensystem..13
  • Das Experiment im Royal Free Hospital in London oder die wunderbare Wirkung der Bircherschen Rohkostbehandlung15
  • Die Patientin mit sekundär-chronischer Polyarthritis.16
  • Grenzen der Heilungsmöglichkeit.18
  • Wissenschaftliche Grundlagen der Ordnungstherapie der rheumatischen Krankheiten22"Der rheumatische Formenkreis" 27
  • Die chronische Polyarthritis (cP oder pcP)27
  • Die Spondylarthritis ankylosans (Morbus Bechterew)28
  • Die Psoriasisarthritis.28
  • Die juvenile chronische Arthritis....29
  • Die Kollagenosen oder Konnektivitiden 29
  • Die Polymyalgia rheumatice..30
  • Die Gicht.31
  • Der Weichteilrheumatismus..31
  • Infektiöse Arthritiden31
  • Die Arthrose32
  • Die Behandlung der rheumatischen Krankheiten33
  • Die Ordnung der Nahrungsmittel, der Mahlzeiten und der
  • Lebensweise.33
  • Die Befreiung von Infektherden und Schwer-
  • metallbelastung..36
  • Die Physiotherapie.38
  • Die Bewegungstherapie..38
  • Die Hydrotherapie..39
  • Der Kohlwickel..40
  • Der Quarkwickel40
  • Die Heilerde41
  • Die Heublumen41
  • Der Fango..41
  • Der Nackenguss nach Kneipp.42
  • Der Lendenguss nach Kneipp.42
  • Die Dampfkompresse nach Kneipp.42
  • Pflanzliche Heilmittel bei Rheuma.43
  • Die Behandlung von Infektionen..44
  • Die homöopathische Therapie.45
  • Die neue wissenschaftliche Akupunktur48
  • Manualtherapie, Chiropraktik und Osteopathie.48
  • Die Neuraltherapie nach Huneke.49
  • Medikamentöse Behandlung50
  • Die operative Behandlung.53
  • Der Heilplan54
  • Die Heildiät.54
  • Zur Vorbeugung und zur Vermeidung von Rückfällen55
  • Die vier Diätstufen58
  • Die Diätstufe 1.58
  • Die Diätstufe 2.60
  • Die Diätstufe 3.62
  • Kleine Austauschtabelle für tierische Produkte, die bei Diät-
  • stufe 3 weggelassen werden müssen..63
  • Die Diätstufe 4.64
  • Die Rezepte.66
  • Säfte ..67
  • Müesli.69
  • Rohgemüse
  •  
  • und Salate.72
  • Salatsaucen.74
  • Milcharten77
  • Butter,Pflanzenfette und Öle. Schonendes Kochen und
  • Dämpfen.78
  • Suppen..80
  • Gemüse.85
  • Salate von gekochten Gemüsen...95
  • Kartoffelgerichte.97
  • Getreidespeisen.100
  • Saucen..105
  • Belegte Brötchen108
  • Süssspeisen...109
  • Gesundheits-Tees..115
  • Rezeptverzeichnis..117
  • Literaturverzeichnis.119
  • Sachregister.122

Handbuch für Rheuma-und Arthritiskranke:
Diesem Handbuch liegt das Wissen und die jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Bircher-Benner (Hand)buch Nr.14 für Magen- und Darmkranke mit Rezeptteil und ausgearbeiteter Kurplan aus einem ärztlichen Zentrum modernster Heilkunst.

Diätanleitung für gesunde und kranke Tage, eingehende Ratschläge.

Magen und Darm sind dem Menschen nicht nur für die Einverleibung von Speise und Trank gegeben, sie bilden auch ein umfassendes, wohl aufgebautes, mehrfach gestuftes Vorwerk unseres Organismus in seiner Selbstbehauptung gegenüber den krankmachenden Einflüssen der Umwelt. Der ganze Verdauungstrakt beherbergt so zu sagen eine innere Aussenwelt, die durch unseren Körper hindurch dringt und ihn unzähligen mechanischen, chemischen und mikrobiellen Reizen und Einflüssen aussetzt, gegen die er sich abgrenzen und sich wehren muss. Der Bau, die zellulären und biochemischen Funktionsweisen des Magen-Darmtraktes sind genial konzipiert, um der ständigen Unterscheidung von Fremd und Eigen, von Nützlichem, Lebensnotwendigem und Schädlichem, Zerstörerischem, das durch ihn hindurch dringt, gewachsen zu sein, ein Meisterwerk der Natur. Über Jahrmillionen entstanden, ist auch die Symbiose, das Zusammenwirken unseres Darmes mit den etwa 20 Billionen Keimen unserer Darmflora, einem komplexen Oekosystem, ohne das kein Überleben möglich wäre. So lange unser Verdauungssystem gut erhalten und einsatzbereit ist, sind wir auch vor vielen Folgen, Mängeln und Fehlern in der Ernährung geschützt. Sind Magen- und Darm geschwächt oder erkrankt, so werden sie zur Ursache allgemeiner Kränklichkeit, denn damit gerät das ganze biologische System nach und nach aus seinem komplexen, dynamischen Gleichgewicht. Darum müssen Magen- und Darmkranke Menschen in ihrer Ernährungsweise sehr sorgfältig sein. Sie müssen die Gesundheit des Darmmilieus möglichst rasch wieder herstellen, um nicht in den folgenden Jahren an allgemeinen, degenerativen Krankheiten zu leiden. Von einer energetisch und stofflich gesunden Ernährung, von einem gesunden biochemischen und mikrobiellen Milieu im Verdauungstrakt hängt das ganze komplexe System unseres Stoffwechsels ab, die Erhaltung unserer Grundregulation, der gesamte Energie- und Informationsfluss im biologischen System unseres Körpers. Die Qualität der Nahrung entscheidet über unser Schicksal, über Regeneration oder Degeneration, über gesund oder krank.

In dieser Handbuchreihe geht es darum, das nötige Wissen zu vermitteln, um zu verstehen, wie die in unserer Zeit immer häufiger und immer früher im Leben auftretenden chronischen Krankheiten verhütet und geheilt werden können. Zur praktischen Anwendung findet man zusammengefasst vorbeugende und heilende Diätanweisungen und Massnahmen, welche die Selbstheilungsbemühungen des Organismus unterstützen und steuern. Unsere Erklärungen und Anweisungen beruhen auf den bis heute zugänglichen wissenschaftlichen Erkenntnissen.
In Jahrzehnte langer Erfahrung sind unsere Diätanweisungen verfeinert. Sie erweisen sich als äusserst wirksam. Klar und gut verständlich wird gezeigt, wie zur Heilung von Magen-Darmkrankheiten in der Praxis vorgegangen werden muss. In jedem Falle empfehlen wir eine enge Zusammenarbeit mit Ihrem behandelnden Arzt. Für ihn ist dieses Buch eine wertvolle Hilfe bei der Betreuung seines Patienten.

Braunwald, 22.Januar 2014 Dr. med. Andres Bircher

Inhalt:

Vorwort...7

  • Der Bau des Verdauungssystems...8
  • Der Mund...8
  • Die Speiseröhre...9
  • Der Magen...9
  • Der Zwölffingerdarm (Duodenum)..9
  • Die Bauchspeicheldrüse (Pankreas)...10
  • Das Jejunum...10
  • Das Ileum...11
  • Der enterohepatische Kreislauf...11
  • Der Dickdarm (Kolon)............12
  • Das Immunsystem des Darms...............12
  • Die Darmflora...13
  • Die Regulation des Verdauungssystems...13
  • Die hormonelle Regulation der Verdauung...14
  • Erkrankungen der Speiseröhre...15
  • Schluckstörungen...15
  • Die Refluxkrankheit und der Zwerchfellbruch (Zwerchfellhernie)..15
  • Der Barrett-Oesophagus (Endobrachyoesophagus)...15
  • Die Therapie der Refluxkrankheit und des Barrettsyndroms..15
  • Der Ösophaguskrebs (Oesophaguscarcinom)...16
  • Erkrankung des Magens...17
  • Die Magenentzündung (Gastritis)...17
  • Der übersäuerte Magen (chronische Gastritis)...17
  • Der säurearme, schlaffe Magen...17
  • Die Fehlbesiedlung des Magens mit Helicobacter pylori...18
  • Der Magenkrebs...18
  • Erkrankungen der Bauchspeicheldrüse...20
  • Die akute Bauchspeicheldrüsenentzündung (akute Pankreatis)...20
  • Die chronische Pankreatitis...20
  • Der Pankreaskrebs.(Pankreaskarzinom)...20
  • Das Versagen der Bauchspeicheldrüse (Pankreasinsuffizienz)...20
  • Erkrankung des Darms...22
  • Das Zwölffingerdarmgeschwür (Ulcus duodeni)...22
  • Der Darmkatarrh (Enteritis, Colitis, Gärung, Fäulnis)...22
  • Darmträhgheit und Durchfall...23
  • Darmfäulnis und Gärung, die bakterielle Fehlbesiedlung...24
  • Die Fehlbesiedlung des Dünndarms...25
  • Die Darmfäulnis...25
  • Die Therapie der bakteriellen Fehlbesiedlung...26
  • Die Blinddarmentzündung...27
  • Die Blähsucht (Meteorismus)...27
  • Das Reizdarmsyndrom...29
  • Die Zölliakie (Hertersche Krankheit)...30
  • Die Laktoseintoleranz...33
  • Die Fruktoseintoleranz...34
  • Die Histaminintoleranz...35
  • Das Problem der Nahrungsmittelallergie...36
  • Die Crohn'sche Krankheit...37
  • Die Colitis ulcerosa...42
  • Die Divertikelkrankheit (Divertikulose)...46
  • Der Dickdarmkrebs (Colon-Karzinom)...47
  • Die Wirkung der Nahrung auf den Verdauungstrackt...50
  • Zweierlei Nahrungsenergie...50
  • Allgemeine Richtlinien für die Therapie der Darmerkrankung...53
  • Die Rohapfelkost (besonders bei Durchfallerkrankungen)...53
  • Die Rohkostdiät...53
  • Die Sauermilchdiät...54
  • Hinweis zur Auswahl der Nahrungsmittel...54
  • Kostformen...56
  • Kost 1 Teefasten...56
  • Kostform 2 Säftekost...56
  • A. Bei Akutem Durchfall...56
  • B. Bei übersaurem Magen, Ulcuskrankheit...58
  • C. Bei Säurearmem Magen...59
  • Kostform 3 Pürierte Kost (Breiform)...60
  • Kost 4 Schon-Heilkost...62
  • Kost 5 Schutz-Heilkost...63
  • Die Dauerdiät bei Neigung zu Verstopfung...64
  •  
  • Die Rezepte...66
  • Säfte...66
  • Gesundheits-Tees...67
  • Birchermüesli...68
  • Rohgemüse und Salate...70
  • Salatsaucen...72
  • Vorschläge für passende Saucen zu Salaten und Rohgemüse...74
  • Milcharten...75
  • Butter, Pflanzenfette und Öle-Schonendes Kochen und Dämpfen...75
  • Suppen...76
  • Gemüse...80
  • Salate von gekochten Gemüsen...86
  • Kartoffelgerichte...88
  • Getreidespeisen...90
  • Saucen...93
  • Belegte Brötchen...95
  • Desserts...96
  • Vorschläge von Speisezetteln geordnet nach verschiedenen Konsistenzformen.100
  • Zusammenfassung der Lebensmittel für Heildiät von Verdauungsleiden...104
  • Indikationen zu allgemeinen Anwendungen bei Magen-Darm-Krankheit...106
  • Bäder...106
  • Reibesitzbad nach Kuhne...106
  • Wechselwarmes Fussbad...106
  • Kaltes Halbbad...106
  • Waschungen...107
  • Kalte Bauchwaschung...107
  • Ganzwaschung...107
  • Leibwaschung...107
  • Unterleibswaschung...107
  • Bauchwaschung...107
  • Kalte Güsse...108
  • Schenkelguss...108
  • Unterleibsguss nach Winternitz...108
  • Wickel...108
  • Leibwickel,(Rumpfwickel) nach Kuhne und Priessnitz...108
  • Kompressen und Auflagen...109
  • Dampfkompresse nach Kneipp...109
  • Massagen...109
  • Die Bauchmassage nach Winternitz...109
  • Diättabelle für Magen-Darmkranke...110
  • Literaturverzeichnis...114
  • Rezeptverzeichnis...119
  • Stichwortverzeichnis...12

Produktinformationen zu „Bircher-Benner-Handbuch: Bd.14 Bircher-Benner Handbuch für Magen-und Darmkranke“.

Diesem Handbuch liegt das Wissen und die Jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute medizinisches Zentrum Bircher- Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohl- schmeckenden, erprobten, ab- wechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Bircher-Benner (Hand)buch Nr. 15 für die Ernährung in der Schwangerschaft und Stillzeit

Dieses Buch ist für Frauen geschrieben, welche nach der besten, natürlichen und auf neuester wissenschaftlicher Evidenz basierenden Ernährung für ihre Schwangerschaft und Stillzeit suchen

Für das ganze Leben des Kindes und die Mutter selbst ist die Ernährung während der Schwangerschaft und der Stillzeit von entscheidender Bedeutung. Die Sushruta-Texte der ayurvedischen Medizin zeigen, dass man in Indien bereits 1500 Jahre vor Christus während der Schwangerschaft die Morgenübelkeit und ungewöhnliche Esssucht durch vegetarische Diät und Heilpflanzen behandelte. Jedem Stadium der Schwangerschaft war eine besondere Ernährung zugeordnet und man pflegte den seelischen und körperlichen Zustand schwangerer Frauen sorgsam, nach bestem Wissen und Gewissen. Von einigen Lebensmitteln riet man bereits damals ab, da sie eine Fehl- oder Frühgeburt verursachen können. Die Ärzte der griechischen Antike hatten es besonders schwer, denn sie standen in Konkurrenz zum Gott Asklepios, dem Sohn des Apollon, denn die Menschen schenkten in dessen Fähigkeiten mehr Vertrauen als den Ärzten. Hippokrates von Kos liess sich davon nicht beeindrucken. Er wurde zu einem grossen Pionier und prägte die medizinische Wissenschaft bis in die Neuzeit. Im 5. Jahrhundert vor Christus verkündete er die Botschaft, dass Krankheiten nicht durch Götter entstehen, sondern eine natürliche, organische Ursache haben und nicht durch Götter, sondern durch Ärzte, geheilt werden können. Er kannte die Anatomie des menschlichen Körpers schon recht gut und erkannte die Wirkung der Ernährungs- und Lebensweise auf die körperliche und geistige Verfassung und Konstitution der Menschen. Seine Botschaft war eine Kampfansage an die Götter. Damit wurde Asklepios sein Rivale. Die Römer nannten ihn dann Aesculap. In Asklepios Heiligtum gab es Brunnen mit Schlangen, zum Austreiben von Krankheiten. Noch heute gilt eine Schlange, die einen Stab umzingelt, als Symbol medizinischer Heilkunst. In Scharen pilgerten Kranke und Gebrechliche nach Epidauros auf dem Peloponnes, nach Pergamon und nach Kos, zu den Heiligtümern des Asklepios, die heute zu Sehenswürdigkeiten geworden sind.

Besondere Hoffnung setzten die Kranken in die «Inkubation», was bedeutete, dass man sich in einem Besonderen Raum zum «Tempelschlaf» niederlegte. Dort verbrachte man eine Nacht. Es hiess, dass Asklepios die Kranken manchmal noch in derselben Nacht von ihrer Krankheit befreite oder dass er ihnen im Traum erschien, um ihnen gute Ratschläge zu geben, die man am anderen Morgen mit den Priestern des Tempels besprach. Um 300 v. Christus soll Heraeus das Asklepios-Heiligtum von Epidauros aufgesucht haben, da auf seinem Kopf kein Haar wuchs. Während des Tempelschlafs salbte ihn Asklepios mit einem Heilmittel ein, wonach das Haar wieder gewachsen sei. Kleo soll 5 Jahre lang schwanger gewesen sein, ohne dass es zur Geburt kam. Da schlief sie im Tempel des Asklepios und sobald sie das Heiligtum verliess, soll sie einen fünfjährigen Sohn geboren haben, der sich selbst an einer Quelle wusch und mit der Mutter zu Fuss nach Hause ging. Natürlich zweifelten auch damals manche Menschen an der Wahrheit solcher Geschichten und an Asklepios Heilkunst, so auch Ambrosia aus Athen, die an einem Auge blind war. Doch soll ihr Asklepios im Traum erschienen sein und sie geheilt haben, unter der Bedingung, dass sie ihm als Zeichen ihrer Dummheit ein silbernes Schwein im Tempel aufstellte. Im alten Griechenland zirkulierten viele solche Geschichten über Wunderheilungen und man wusste nicht um deren Wahrheit. Wohl hatte das Ambiente des Heiligtums, der Glaube an die Nähe zum göttlichen Asklepios bedeutende Wirkungen, wie auch gewisse Rituale, die dem Kranken zeigten, dass er mit seinem Leiden ernst genommen wird.

Für Hippokrates hatten Krankheiten und deren Heilung nichts mit Göttern zu tun. Der Arzt war gefordert, jeden Krankheitsfall genau zu analysieren, um zu einer Diagnose, einer Therapie und zu einer Prognose zu gelangen. Anschließend kam alles darauf an, die richtige Arznei und die richtige Therapie zu verordnen. Hippokrates lehrte den Menschen und seinen Schülern, dass der Organismus von sich aus wieder gesund werden will und dass die Aufgabe des Arztes und des Patienten darin besteht, die Heilungsanstrengungen des Organismus zu unterstützen und die Heilungskraft zu stärken.

Der Begriff «Diaita (δίαιτα)» bezog sich nicht nur auf eine heilende Nahrung, sondern auf die ganze Lebensordnung. Hippokrates Schüler lehrten den Patienten eine umfassende Pflege der Gesundheit und Behandlung von Krankheiten, auch in der Schwangerschaft, durch eine heilende Ernährung, durch richtiges Trinken, richtiges sich Bewegen und Baden, durch eine neue, umfassende Lebensordnung. Die Diät bestand in erster Linie aus frischem Obst und Rohgemüse, Hülsenfrüchten, Vollkornbrot, Nüssen, Fisch und etwas Käse. Damit hatte Hippokrates als erster die zentrale Bedeutung einer lebendigen Frischkost für die Gesundheit der Menschen erkannt. Obschon auch er bereits Acetylsalicylsäure (Aspirin) aus der Weidenrinde isolierte und gegen Schmerzen verschrieb, lehrte er seinen Schülern und Patienten stets seinen berühmten Satz: „Unsere Nahrungsmittel sollen unsere Heilmittel und unsere Heilmittel sollen Nahrungsmittel sein.“

Auch den Ärzten und Gelehrten des Mittelalters war die grosse Bedeutung der Ernährung während einer Schwangerschaft und Stillzeit für die Mutter und für die Entwicklung des Kindes bewusst. Sie bezogen diese Kenntnisse aus Schriften von Gelehrten des 5. bis 7. Jahrhunderts, die von Ärzten wie Oribasius von Byzanz, Aëtios von Amida, und Paulos von Aigina verfasst worden waren. In diesen Schriften ging es besonders darum, wie man Komplikationen der Schwangerschaft meistern kann.

In der modernen Medizin herrschte bis vor 40 Jahren unter den Ärzten erstaunlich viel Unkenntnis. Die Meisten rieten den Frauen, sich weiterhin so zu ernähren, wie sie es gewohnt waren und vertraten die Meinung, dass etwas Alkohol und mässiges Rauchen nicht schädlich seien. Erst in neuester Zeit wurde schliesslich die grosse Bedeutung gesunder Ernährung in der Schwangerschaft und Stillzeit erkannt.

Dieses Buch ist für Frauen geschrieben, welche nach der besten, natürlichen und auf wissenschaftlicher Evidenz basierenden Ernährung für ihre Schwangerschaft und Stillzeit suchen, nach einer Ernährung, welche Beschwerden und Komplikationen während der Schwangerschaft wirksam verhindert, welche dem Kind für seine Entwicklung und sein späteres Erwachsensein optimale Bedingungen schafft und dafür geeignet ist, für ihre eigene Gesundheit als Mutter und die Rückbildung optimale Bedingungen zu schaffen. Als Diäthandbuch ergänzt es das Handbuch Nr. 16: «Für Frauenleiden und die Wechseljahre», in welchem die Schwangerschaft, die Geburt und die Stillzeit eingehend behandelt werden und enthält Anleitungen und wohlschmeckende Rezepte, bereit zur praktischen Anwendung. Dem Arzt bedeutet es eine bedeutende Hilfe und Zeitersparnis bei der Beratung seiner Patientinnen.

Dr. med. Andres Bircher

Inhalt:

  • Vorwort …………………………………………………………………………..9
  • Ernährungsfehler und ihre Folgen………………………………………………12
  • Alkohol und Rauchen …………………………………………………………..12
  • Das fetale Alkoholsyndrom …………………………………………………….12
  • Der Mehrbedarf an Kalorien durch die Schwangerschaft………………………14
  • Die natürliche Gewichtszunahme während der Schwangerschaft………………14
  • Übergewicht und die Schwangerschaft………………………………………….15
  • Die empfohlene Gewichtszunahme in der Schwangerschaft …………………...15
  • Der Eiweissbedarf in der Schwangerschaft…………………………………….. 16
  • Vegane Ernährung in der Schwangerschaft und Stillperiode …………………...16
  • Der Bedarf an Kohlenhydraten in der Schwangerschaft…………………………17
  • Glykämischer Index und glykämische Ladung ………………………………….17
  • Der Schwangerschaftsdiabetes …………………………………………………..18
  • Der Bedarf an Nahrungsfasern …………………………………………………..19
  • Der Bedarf an pflanzlichen Fetten und Ölen……………………………………..19
  • Der Bedarf an Vitaminen und Mineralstoffen…………………………………... 20
  • Der Bedarf an Folsäure …………………………………………………………..20
  • Der Bedarf an Vitamin D…………………………………………………………20
  • Der Bedarf an Eisen während der Schwangerschaft……………………………...21
  • Die Bedeutung von Jod in der Schwangerschaft …………………………………22
  • Der Bedarf an Flüssigkeit und Getränken………………………………………... 22
  • Der Bedarf an Kochsalz …………………………………………………………..22
  • Übelkeit und Erbrechen…………………………………………………………...23
  • Die Emesis gravidarum …………………………………………………………...23
  • Die Hyperemesis gravidarum……………………………………………………...23
  • Die Präeklampsie (Spätgestose)…………………………………………………...25
  • Die Eklampsie …………………………………………………………………….25
  • Die diätetische Therapie der Präeklampsie………………………………………. 26
  • Heisshunger, Gelüste oder Ekel…………………………………………………...27
  • Ödeme in der Schwangerschaft …………………………………………………...27
  • Muskelkrämpfe…………………………………………………………………….27
  • Sodbrennen ………………………………………………………………………..28
  • Blähungen und Völlegefühl ……………………………………………………….28
  • Obstipation ………………………………………………………………………...28
  • Nahrungsmittel, welche den Darm anregen………………………………………..28
  • Schwangerschaftstees……………………………………………………………...29
  • Heilpflanzen, die in der Schwangerschaft nicht angewendet werden dürfen……...30
  • Folgende Pflanzen und Gewürze dürfen in der Schwangerschaft
  • in kleiner Menge verwendet werden ………………………………………………31
  • Kräuter, die in der Schwangerschaft nicht verwendet werden dürfen……………..31
  • Natürliche Arzneien und Gewürze, die in der Schwangerschaft nicht
  • verwendet werden dürfen………………………………………………………… .33
  • Heilpflanzen, welche den Embryo oder Fetus schädigen können ………………....33
  • Das Stillen………………………………………………………………………….34
  • Das Problem der künstlichen Stimulation  der Geburtswehen
  • durch synthetisches Oxytocin ……………………………………………………..36
  • Die Muttermilch……………………………………………………………………37
  • Nährstoffe der Muttermilch………………………………………………………...37
  • Die Besonderheit des Kolostrums………………………………………………….37
  • Die „reife“ Muttermilch ……………………………………………………………38
  • Details der Zusammensetzung der Muttermilch……………………………………38
  • Enzyme und Hormone der Muttermilch……………………………………………39
  • Der Anteil an Vitalstoffen (Mikronährstoffen) …………………………………….39
  • Die Haltbarkeit der Muttermilch……………………………………………………40
  • Die Förderung der Bildung der Muttermilch……………………………………….40
  • Die Ernährung während der Stillzeit………………………………………………..42
  • Der Einfluss der Ernährung der Mutter auf die Qualität der Brustmilch …………..42
  • Die Bedeutung der vegetabilen Frischkost…………………………………………,43
  • Der Eiweissbedarf während des Stillens……………………………………………44
  • Der Vitaminbedarf während der Stillperiode……………………………………….44
  • Der Bedarf an Jod, Calcium und Eisen während des Stillens………………………44
  • Die Versorgung mit Calcium während des Stillens und die Osteoporose …………45
  • Der Bedarf an Eisen während der Stillperiode……………………………………...45
  • Der Flüssigkeitsbedarf während des Stillens………………………………………..45
  • Alkohol und die Stillperiode………………………………………………………...46
  • Die vegane Ernährung in der Stillzeit……………………………………………….46
  • Kindliche Allergien durch Allergene in der Nahrung der Mutter…………………...46
  • Medikamente in der Stillperiode……………………………………………………...47
  • Die „relative kindliche Dosis“………………………………………………………..47
  • Stillen nach einer Anästhesie und Narkose…………………………………………...47
  • Muskelrelaxantien ……………………………………………………………………48
  • Lokalanästhetika………………………………………………………………………48
  • Anticholinergika………………………………………………………………………48
  • Beruhigungsmittel, Schlafmittel………………………………………………………48
  • Schmerzmittel…………………………………………………………………………49
  • Antiemetika……………………………………………………………………………49
  • Antibiotika…………………………………………………………………………….49
  • Mittel gegen Bluthochdruck (postpartale Hypertonie)………………………………..49
  • Naturheilmittel für die Stillzeit………………………………………………………..51
  • Oleum gynaecologicum……………………………………………………………….51
  • Mittel gegen Hautreizungen …………………………………………………………..51
  • Mittel bei wunden Brustwarzen……………………………………………………….51
  • Praktischer Teil………………………………………………………………………..52
  • Speisezettel und Rezepte………………………………………………………………52
  • Speisezettel ……………………………………………………………………………53
  • Vorschläge für das Frühstück …………………………………………………………53
  • Fünf verschiedene Vorschläge für das Mittagessen…………………………………...53
  • Fünf verschiedene Vorschläge für das Nachtessen …………………………………...54
  • Vorschläge für einen wöchentlichen Rohkosttag ……………………………………..54
  • Diät vor der Geburt (salzlos)…………………………………………………………..55
  • Diät im Wochenbett und beim Stillen…………………………………………………55
  • Diät bei Übergewicht………………………………………………………………….56
  • Diät bei Untergewicht…………………………………………………………………57
  • Diät bei Obstipation…………………………………………………………………...58
  • Diät bei Durchfall……………………………………………………………………...58
  • Diät bei Übelkeit………………………………………………………………………59
  • Diät bei Magen-, Darm- und Leberstörungen…………………………………………61
  • Diät bei Nierenstörungen und Wasserrückhalt……………………………………….. 62
  • Rezepte………………………………………………………………………………...64
  • Obstgerichte und Birchermüesli ………………………………………………………64
  • Süss-Speisen mit Früchten, Getreide und Kernen …………………………………….65
  • Das Birchermüesli……………………………………………………………………..65
  • Rohgemüse…………………………………………………………………………….67
  • Zur Rohkost geeignete Salate und Gemüse und dazu passende Kräuter
  • und Saucen…………………………………………………………………………….70
  • Die Zubereitung der Rohkost………………………………………………………….71
  • Salatsaucen…………………………………………………………………………….72
  • Belegte Brötchen ……………………………………………………………………...73
  • Grundaufstrich…………………………………………………………………………73
  • Frischsäfte……………………………………………………………………………...74
  • Fruchtsäfte ……………………………………………………………………………..74
  • Gemüsesäfte……………………………………………………………………………74
  • Milchrezepte…………………………………………………………………………....75
  • Pflanzenmilch…………………………………………………………………………..77
  • Butter, Pflanzenfette und hochwertiges Öl……………………………………………..78
  • Gewürze, frische Wild- und Küchenkräuter…………………………………………....79
  • Gekochte Speisen ………………………………………………………………………79
  • Gemüse………………………………………………………………………………….82
  • Kartoffelgerichte……………………………………………………………………….. 87
  • Getreidespeisen…………………………………………………………………………88
  • Reisgerichte……………………………………………………………………………..90
  • Teigwaren……………………………………………………………………………….93
  • Warme und kalte Saucen………………………………………………………………..94
  • Quark und Käsegerichte………………………………………………………………...96
  • Speisen mit Ei…………………………………………………………………………...98
  • Fleisch…………………………………………………………………………………...98
  • Früchtespeisen und Desserts…………………………………………………………….99
  • Anhang…………………………………………………………………………………102
  • Tabelle zum glykämischen Index und zur glykämischen Ladung
  • der Nahrungsmittel……………………………………………………………………..103
  • Rezeptverzeichnis………………………………………………………………………108
  • Literaturnachweis……………………………………………………………………….111
  • Stichwortverzeichnis……………………………………………………………………114

Handbuch für die Ernährung in der Schwangerschaft und Stillzeit

Dieses Buch ist für Frauen geschrieben, welche nach der besten, natürlichen und auf neuester wissenschaftlicher Evidenz basierenden Ernährung für ihre Schwangerschaft und Stillzeit suchen, nach einer Ernährung, welche Beschwerden und Komplikationen während der Schwangerschaft wirksam verhindert, welche dem Kind für seine Entwicklung und sein späteres Erwachsensein optimale Bedingungen schafft und dafür geeignet ist, für ihre eigene Gesundheit als Mutter und die Rückbildung optimale Bedingungen zu schaffen. Als Diätbuch ergänzt es das Handbuch Nr. 16: «Für Frauenleiden und die Wechseljahre», in welchem die Schwangerschaft, die Geburt und die Stillzeit eingehend behandelt werden und enthält Diätpläne, Anleitungen und wohlschmeckende Rezepte aus einem Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner Klinik, bereit zur praktischen Anwendung.


Bircher-Benner (Hand)buch Nr. 16 für Frauenleiden und die Wechseljahre

Dieses Buch ist für Frauen geschrieben, welche ihr eigenes Wesen besser verstehen möchten und nach einem Weg suchen.

Vorwort

Für Männer war das Wesen der Frau stets etwas Unheimliches, das ihnen Angst machte, so dass sie dazu neigten, Frauen zu kontrollieren und zu unterdrücken. Bis vor 120 Jahren waren alle Ärzte Männer und man sieht aus der Geschichte, dass es ihnen sehr schwer fiel, ihre Patientinnen zu verstehen. Sie entwickelten phantastische Theorien zur Gebärmutter, zu Menstruationsbeschwerden, zu Hitzewallungen, zu seelischen Besonderheiten ihrer Patientinnen, ohne diese wirklich zu verstehen. Sie meinten, dass Menstruationsblut, das nicht abfliessen könne, sich im Körper verteile und Abszesse verursache. Der an sonst geniale griechische Arzt Hippokrates meinte, dass die Gebärmutter im ganzen Körper umherwandere. Diese Idee hielt sich bis in die Renaissance. Man findet sie bei Galenos von Pergamon, bis Paracelsus und Leonardo da Vinci. Die Gebärmutter hiess bei den Griechen  ὑστέρα hystéraoder métra und Galenos war davon überzeugt, dass das Ausbleiben der Menstruation oder unterdrückte Vaginalsekrete Hysterie verursachen. Damit meinte er damals allerhand seelische Leiden, bis hin zu Depressionen und Schizophrenie.

Heute versteht man Hysterie als einen Angstzustand mit einem Verhalten, das unbewusst verzweifelt nach Hilfe, Beachtung und Anerkennung ruft. Nicht umsonst war die Erste eine Frau, nämlich Hildegard von Bingen, welche die Frauenheilkunde von all diesem Aberglauben befreite und „Frauenleiden“ als Fachgebiet betrachtete, mit wirksamen Behandlungsmöglichkeiten. Was bei den Hitzewallungen geschah, konnten die Ärzte nicht verstehen. Diese „Vapeurs“ wurden definiert als „Modekrankheit“ der Damen, durch Beschwerden, die durch zum Gehirn aufsteigende „Blähungen“ verursachte würden und zu „hysterischen“ Launen führen würden. Der deutsche Enzyklopädist, Lexikograph, Naturwissenschaftler und Arzt Johann Georg Krünitz schrieb dazu: „Die Vapeurs zeigen sich gewöhnlich bei Frauenzimmern bei Eintritt oder bei Wegbleiben der Regel, aber auch beim vielen Sitzen, Essen, blähenden Speisen und bei nicht gehörigen Verdauungskräften des Magens etc. Sie gehen von den Nervengeflechten des Unterleibes aus.“ Im 19. Jahrhundert gaben die Ärzte die Theorie der „Vapeurs“ auf und erklärten Hitzewallungen durch zu enges Schnüren des Korsetts, das die Leber einengte. Weiterhin waren sie davon überzeugt, dass die weiblichen Geschlechtsorgane ausserordentlich nervenreich seien und mit den anderen Organen, dem Magen-Darmkanal, dem Herzen und dem „psychischen Anteil des Gehirns“ direkt verbunden seien, so dass sie mannigfache Funktionsstörungen und hysterische Verstimmungen verursachen.“ Zur Behandlung der „Hysterie“ wurde noch bis in die 1930iger Jahre eine sofortige Heirat und Schwangerschaft empfohlen. Auch Vibratoren wurden eigesetzt und seit dem Ende des 19. Jahrhunderts wurde oft chirurgisch vorgegangen, durch Entfernung der Gebärmutter (Hysterektomie) oder deren Lagekorrektur. Die Männer verdrängten ihre eigenen psychischen Regungen sehr und projizierten sie oft auf Frauen. Sigmund Freud war der erste Arzt, der psychische Krankheiten nicht nur bei Frauen, sondern genauso bei Männern diagnostizierte. Dies war die Geburtsstunde der psychologischen Wissenschaft.

Lange standen die Ärzte Menstruationsbeschwerden hilflos gegenüber. Der erste Artikel der sich mit dem Thema Dysmenorrhoe befasste, erschien 1876  im „Archiv für Gynäkologie“. Dann war es wieder still um dieses Thema, bis zwischen 1910 und 1930 sechs weitere Artikel veröffentlicht wurden. Bis 1970 entstanden 246 Artikel, von denen nur 18 sich mit Theorien zur Ursache der Dysmenorrhoe befassten. Noch 1965 schrieb Lukas in seiner Monografie über „Die Dysmenorrhoe“: „Wir bezeichnen als Dysmenorrhoe eine Menstruation, die mit Beschwerden oder Schmerzen von solchem Ausmaß einhergeht, dass die betreffende Frau in ihrem Befinden ernstlich gestört ist und ihrer gewohnten Tätigkeit nicht in üblicher Weise nachgehen kann - Kaum ein gynäkologisches Krankheitsbild ist einerseits so verbreitet und andererseits in seiner Genese so unklar geblieben, wie die Dysmenorrhoe “.

In der Tat sind die Regulationsvorgänge im Körper der Frau äusserst komplex und so subtil aufeinander abgestimmt, dass kleinste Störungen in deren Ablauf Beschwerden verursachen können. Hiermit kann die derzeitige, in analogen Denkschemata verhaftete, materiell eingestellte medizinische Wissenschaft nicht Schritt halten, welche sich gewohnt ist, Beschwerden mit unterdrückenden Medikamenten anzugehen. Auch das typisch weibliche Denken und Handeln ist kybernetisch und viel komplexer als das typisch männliche Denken und ergänzt dieses gerade deshalb in idealer Weise. Die Menstruation, die Schwangerschaft und das Klimakterium sind wunderbare Beispiele dafür, dass unser biologisches System ein äusserst komplexes, genial konzipiertes, offenes Regulationssystem ist, bei dem alle Vorgänge sorgsam aufeinander abgestimmt sind und in dynamischem Gleichgewicht ablaufen, so dass es mit den meist linearen Überlegungen und Forschungsmethoden der aktuellen medizinischen Wissenschaft nicht verstanden werden kann.

Ganz anders als die Männer, haben Frauen mehrere Aufgaben für ein erfülltes Leben. Zur  persönlichen und beruflichen Entwicklung ist ihre Begabung als Mutter zur Geburt und Betreuung von Kindern eine grosse immanente Aufgabe ihres Lebens, die nach Erfüllung ruft, eine Begabung, welche derzeit in der Gesellschaft kaum Beachtung und wenig Unterstützung findet. In allen Kulturen war die Fähigkeit der Frau, in sich ein Kind heranreifen zu lassen und zu gebären den Männern unheimlich und schlug sich in mythologischen Vorstellungen nieder. Wundersame Geburten sind ein verbreitetes Motiv in der historischen Literatur und in religiösen Texten aller Kulturen. Oft geht es dabei um eine Empfängnis durch mysteriöse oder wundersame Umstände, oft unter dem Einfluss einer Gottheit oder übernatürlicher Elemente.

Semele, die Tochter des Königs Kadmos von Theben stirbt wegen der eifersüchtigen Hera durch den Blitz des in sie verliebten Zeus. Doch war sie bereits mit Dionysos schwanger. Da brachte sich Zeus eine tiefe Wunde bei und nähte sich die unreife Leibesfrucht in seinen eigenen Schenkel. Nach drei Monaten öffnete er diesen wieder und brachte Dionysos zur Welt. Dionysos doppelte „Geburt“ begründete seine Unsterblichkeit. Metis lebte mit ihren Zwillingskindern Athene und Mephaistos im Bauch des Zeus. Athene erzeugte Zeus mit einem Speer von innen derart starke Kopfschmerzen, dass sie aus seinem Kopf geboren wurde. Der tierliebende Kintarō hatte übernatürliche Kräfte, denn er wurde von einer Berghexe großgezogen, die durch den Blitz eines roten Drachens geschwängert wurde. Momotarō soll in einem Pfirsich auf die Erde geschwebt sein und auf einem Fluss getrieben haben, bis er von einer kinderlosen Frau gefunden und aufgezogen wurde. Die Prinzessin Kaguya im Manga von Isao Takahata wird von einem Bambusbauern im Inneren eines Bambushalms gefunden und aufgezogen. Als Zeichen göttlicher Herkunft entstand die Schwangerschaft an Chinas mythologischem Herrscher und Ackergott Houji, als seine Mutter in einen riesigen Fußabdruck fiel, der von Shangdi, der höchsten Gottheit des Himmels stammte. Die Mutter des legendären chinesischer Philosophen Laozi, welcher auch als Begründer des Daoismus gilt, wurde schwanger, als sie eine Sternschnuppe erblickte und sich gegen einen Pflaumenbaum lehnte. Er soll 62 Jahre im Leib seiner Mutter verbracht haben, bis er als alter Mann mit Bart und mit ganz langen Ohrläppchen, als Zeichen der Weisheit und für ein langes Leben, zur Welt kam. Er soll 13 Mal wiedergeboren worden sein, bis er in seiner „finalen Form“ im Alter von 990 Jahren starb. Der mongolische Kaiser Liao Taizu wurde im Jahr 872 in der südlichen Mongolei geboren. Seine Mutter soll schwanger geworden sein, als sie träumte, dass die Sonne vom Himmel in ihren Schoß fiel. Nach zwanzig kinderlosen Jahren soll Siddharta Gautamas Mutter schwanger geworden sein, als sie träumte, dass ein weißer Elefant vom Himmel herab in ihren Körper fuhr. Als Zeichen der Reinheit, soll Siddharta Gautamas aus der rechten Seite seiner Mutter ausgetreten sein. Als Mutter Erde über die Sünden der Menschen Indiens erzürnt war, bat sie den Gott Vishna in Form einer Kuh um Hilfe. Vishna erzählte ihr, dass er ihr achter Sohn sei und die Sünden auf der Erde auslöschen werde, stieg hinab in ihren Bauch und wurde als Krishna wiedergeboren. Durch die unbefleckte Empfängnis soll die Gottesmutter Maria vor jedem Makel der Erbsünde, die Adam und der Eva begangen hatten, bewahrt worden sein.

So rankten sich die Mythen und Vorstellung der Menschen um das Phänomen der Schwangerschaft und der Geburt, dieses Meisterwerk der Schöpfung, dem wir auch heute, bei allem naturwissenschaftlichen Verständnis, mit Staunen und Ehrfurcht begegnen. Noch ist die Schwangerschaft teilweise mit Schamgefühl, statt mit Stolz belegt, noch wird im spanischen Sprachraum jede schwangere Frau als „embarazada“ (verlegen) bezeichnet. Die Schwangerschaft ist die Zeit grösster Weiblichkeit im Leben einer Frau, wo sie in der Gesellschaft grösste Ehrfurcht und Achtung verdient.

Auch um das Stillen ranken sich Mythen. Dabei wird besondere die menschliche Grösse späterer Persönlichkeiten durch das Säugen der Milch von Tieren begründet. Am bekanntesten ist wahrscheinlich die Sage der Zwillinge Romulus und Remus, welche die Milch einer Wölfin gesäugt haben sollen. Der griechische Gott Zeus soll von der Nymphe Amaltheia mit der Milch einer Ziege aufgezogen worden sein, Telephos, der Sohn des Herakles, von einem Reh, Kyros I. mit der Milch eines Hundes und Krösus, Xerxes und Lysimachos sollen die Milch einer Stute getrunken haben. Sagen von verlassenen Kindern, die durch tierische Mütter wie Wölfinnen und Bärinnen aufgezogen wurden, waren in Europa bis in die Neuzeit hinein weit verbreitet. Nachdem beflissene Konzerne versuchten, junge Mütter davon zu überzeugen, dass Pulvermilchprodukte für ihr Kind besser seien als Muttermilch, ist eine Vielzahl wissenschaftlicher Studien erschien, welche die enorme Bedeutung der Muttermilch und des Stillens für das Kind und die Mutter selbst belegten. Schwangerschaft, Geburt und die Stillzeit sind Ereignisse grosser Intimität, während welchen Frauen besondere Schonung, Achtung und grossen Respekt verdienen.

Oft sind junge Frauen heute vor die Tatsache gestellt, dass sie unerwünscht schwanger geworden sind. Damit beginnt ein lebenslanger innerer Konflikt. Kann ich es trotzdem austragen und aufziehen? Kann das Kind bei den Eltern aufwachsen? Soll ich es austragen und für eine Adoption frei geben, obschon meine Beziehung zu ihm bis dahin gewachsen sein wird? Oft ist eine frühe Adoption durch gut gewählte Eltern für das Kind eine gute Lösung. Die meisten Frauen wählen dann den Weg eines Schwangerschaftsabbruchs. Doch Immer hinterlässt dies tiefe Schuldgefühle, die anfangs verdrängt werden, um den Weg des Abbruchs der Schwangerschaft überhaupt gehen zu können. Irgendwann im Leben brechen diese Schuldgefühle dann massiv hervor und erzeugen viel Trauer, Selbstvorwürfe und grosses Leid. Jede Frau benötigt, gerade bei unerwünschter Schwangerschaft, viel Verständnis und Hilfe.

Jede siebte Frau erlebt in ihrem Leben eine Fehlgeburt, bevor sie gesunde Kinder auf die Welt bringt. Noch erinnere ich mich an eine junge Frau, die tränenüberströmt ihr erstes, 3 cm grosses Kind in einem Glasfläschchen betrachtete. Nur Frauen können die Tiefe eines solchen Schmerzes wirklich ganz nachfühlen. Um die erste Geburt ranken sich dann oft Ängste: Angst vor den Schmerzen, Angst vor einer Frühgeburt, vor Fehlbildungen oder Geburtsschäden und die Sorge, ob man der Aufgabe eines Kindes gerecht werden wird. Das sind Gefühle, die nur Frauen wirklich erleben und nachvollziehen können.

Ist dann die Familie da, so geraten viele Frauen in einen inneren Konflikt zwischen ihrer beruflichen Begabung und Herausforderung und Ihrer Aufgabe als Mutter. Beidem gerecht zu werden, ist oft ganz schwierig. Es gibt nichts Bedeutenderes, als die Zuwendung und Liebe einer Mutter zu ihrem Kind. Eine gesunde Mutter-Kind-Beziehung bildet das Fundament jeglicher Menschlichkeit. Sind die Kinder klein und zerrt ein jedes den ganzen Tag an einem Ärmel, so kann das Gefühl entstehen, das eigene Leben nicht leben zu können. Dann werden Ansprüche und Erwartungen des Ehegatten zur zusätzlichen Belastung, so dass es oft zu Konflikten kommt, bis zur Trennung. Dies sind Zeiten, wo grosses Verständnis, Reife und Hilfe des Vaters notwendig sind, sonst wird gar manches, was eine Mutter leistet, zur Selbstverständlichkeit. Dann kommt die Pubertät der Kinder und die vielen, meist ungerechten Vorwürfe. Dann ist die Aufgabe, zu unterscheiden, welche Vorwürfe berechtigt sind und welche nicht, oft schwierig. Wir haben nie eine gute Mutter gesehen, die nicht ständig bei sich Fehler suchte. Diese Vorwürfe zu ertragen kann sehr schmerzhaft sein, bis die Kinder viel später endlich erwachsen werden und ihrer Mutter Verständnis, Anerkennung und Dankbarkeit entgegenbringen.

Dann kommt das Klimakterium mit starken seelischen und körperlichen Veränderungen. Es kommt daher, wie ein zweites Leben, mit neuen Möglichkeiten, das nach einer anderen,  neuen Identität und einer zweiten Erfüllung ruft. Unvergleichbar ist dies mit dem Klimakterium des Mannes, das kaum eine weitere Entwicklung von ihm fordert. Auch diese Veränderung der Frau findet in unserer Gesellschaft keine Resonanz, in einer Gesellschaft, welche den Menschen alle scheinbaren Bedürfnisse und Gelüste durch Bildnisse junger Frauen zu erwecken sucht. Dabei formen sich, wenn man gesund ist, die Gesichtszüge im dritten Lebensabschnitt  erst richtig aus, als ein Bildnis der Persönlichkeit. Vielen Frauen fällt es schwer, sich mit dieser Veränderung abzufinden und sie empfinden dies als  hässlich und als Zeichen rascher Alterung, als ein Aussehen, das in dieser Gesellschaft nichts zu suchen hat. Dies ist oft Ursache grosser, stiller Traurigkeit, die daran hindert, den Weg in ein zweites, erfülltes Leben zu finden. Auch verändert das Klimakterium den Stoffwechsel, so dass man sich besonders gesund ernähren muss und man darf nicht dem Naschen verfallen, um nicht an Gewicht zuzunehmen, so dass das Aussehen keine Freude mehr macht.

Frauen im dritten Abschnitt ihres Lebens sind für unsere Gesellschaft ganz besonders wichtig. Sie haben die grösste Lebenserfahrung, haben sich in der Zuwendung und dem Verständnis ihrer Kinder jahrelang geübt und sind zu persönlicher Reife gelangt, welche für andere Menschen von grosser Bedeutung ist. Wer dies nicht erkennen kann, riskiert mutlos und traurig zu sein.

Zyklusstörungen, Menstruationsbeschwerden und klimakterische Beschwerden können nicht durch unterdrückende Medikamente behandelt werden. Hier ist ein regulatives Verständnis gefragt und sind Behandlungsmethoden notwendig, welche die Ursachen angehen, statt Symptome zu unterdrücken. Das Heilen dieser Funktionsstörungen fordert grosses Verständnis für das typisch Weibliche, für seelische und regulative Vorgänge des Menschen und viel Empathie, nicht nur Verständnis für die hormonellen Vorgänge und Veränderungen, sondern auch für das, was im Stoffwechsel geschieht und Anlass zu grossem Leid geben kann durch Schmerzen und Verstimmungen, die man vermeiden kann.

Dieses Buch ist für Frauen geschrieben, welche ihr eigenes Wesen besser verstehen möchten und nach einem Weg suchen, ihren Beschwerden in natürlicher Weise zu begegnen und diese zu heilen. Es ist auch für Männer geschrieben, welche dies besser verstehen möchten. Dem behandelnden Arzt ist dieses Buch eine bedeutende Hilfe bei der Führung und Behandlung seiner Patientinnen.

Inhalt:

  • Vorwort ………………………………………………………………………………………….7
  • Die weiblichen Organe………………………………………….……………………………. 12
  • Der Menstruationszyklus ………………………………………………………………………13
  • Das Follikelstimulierende Hormon (FSH)…………………………………………………… 15
  • Das Luteinisierende Hormon (LH)…………………………………………………………… 15
  • Der LH-Test (Ovulationstest) …………………………………….………………………….....16
  • Östrogene …………………………………………………………….…………………………16
  • Das Progesteron (Gestagen)…………………………………………..………………………. 17
  • Oxytocin ………………………………………………………………………………………..17
  • Der Eisprung ……………………………………………………………………………………18
  • Störungen der Ovulation und verschiedene Zyklusformen…………………………………… 20
  • Die künstliche Induktion der Ovulation…………………………………………………………20
  • Andere medikamentöse Methoden zur Stimulation der Ovulation……………….…………… 21
  • Mittel aus der Naturheilkunde ……………………………………………….………………….21
  • Die Befruchtung ……………………………………….……………….………………………..25
  • Die Empfängnisregelung……………………….……………………………………………… 27
  • Mechanische Verhütungsmethoden……………………………………………….…………… 28
  • Hormonelle Verhütungsmethoden ……………………………………………………………….28
  • Die Nebenwirkungen der hormonellen Antikonzeption …………………………………………30
  • Die Schwangerschaft (Gestation)………………………………………………………………. 34
  • Die Berechnung des Geburtstermins ……………………………………………………………..34
  • Das Erste Trimenon…………………………………………………………………………….. 35
  • Das zweite Trimenon…………………………………………………………………………… 36
  • Das dritte Trimenon ………………………………………………………………………………37
  • Gestosen ………………………………………………………………………………………….40
  • Suchtmittel und Medikamente und die Schwangerschaft ……………………………………….43
  • Homöopathische Mittel für die Schwangerschaft ……………………………………………….48
  • Spagyrik für die Schwangerschaft ……………………………………………………….………49
  • Auch in der Pflanzenheilkunde gibt es Arzneien,
  • die in der Schwangerschaft nicht verwendet werden dürfen. ……………………………………52
  • Die Geburt (Partus, Niederkunft)………………………………………………………………. 53
  • Die Eröffnungsphase…………………………………………………………………………… 54
  • Die Übergangsphase…………………………………………………………………………… 56
  • Die Austreibungsphase………………………………………………………………………… 56
  • Die Nachgeburtsphase …………………………………………….……………………………..56
  • Medizinische Interventionen…………………………………….……..……………………… 57
  • Die Geburtsschmerzen………………………………………………………………………… 58
  • Die natürliche Geburt…………………………………………………….……………………. 59
  • Die Kaiserschnittentbindung……………………………………………..……………………. 60
  • Die Homöopathische Unterstützung für die Geburt…………………………………………… 61
  • Die Wechseljahre (Klimakterium)…………………………………………………………….. 64
  • Das Klimakterium wird in eine Prae- und eine Perimenopause unterteilt:……………………. 64
  • Vorzeitige Wechseljahre …………………………………………………………………….…..65
  • Die Wechseljahrbeschwerden …………………………………………………….……….…….65
  • Die allgemein übliche Behandlung der klimakterischen Beschwerden……………….………. 65
  • Die Sicht der traditionell chinesischen Medizin (TCM)………………………………………. 66
  • Klimakterische Beschwerden und der Schlaf…………………………………………………. 66
  • Klimakterium und Bewegung …………………………………………………………………..66
  • Pflanzliche Mittel gegen klimakterischeBeschwerden………………………………………… 67
  • Homöopathische Mittel gegen Wechseljahrbeschwerden…………………………………….. 69
  • Die Behandlung der Trockenheit der Scheide und urogenitaler Infekte……………………… 70
  • Die Ernährung und die Wechseljahre…………………………………………………………. 71
  • Die Osteoporose……………………………………………………………………………….. 71
  • Zum Problem der Therapie mit Bisphosphonaten…………………………………………….. 73
  • Menstruationsbeschwerden ……………………………………………………………………..74
  • Die primäre Dysmenorrhoe…………………………………………………………………… 74
  • Das Prämenstruelle Syndrom (PMS)………………………………………………………….. 75
  • Die Ernährung und die primäre Dysmenorrhoe……………………………………………….. 75
  • Pflanzliche Heilmittel bei Dysmenorrhoe und Prämenstruellem Syndrom…………………… 76
  • Regelmässige körperliche Aktivität…………………………………………………………… 79
  • Die sekundäre Dysmenorrhoe…………………………………………………………………. 81
  • Die Endometriose ……………………………………………………………………………….81
  • Die diätetische Therapie zur Verhütung und Heilung der Endometriose……………………... 83
  • Erkrankungen des Eierstocks (Ovar)…………………………………………………………….88
  • Das Ovarialkarzinom………………………………………………………………………….. 89
  • Erkrankungen der Eileiter……………………………………………………………………… 95
  • Die Eileiterschwangerschaft (EUG)…………………………………………………………… 95
  • Die Eileiterentzündung (Salpingitis)…………………………………………………………… 95
  • Eileiterkrebs (Tubenkarzinom) …………………………………………………………………..95
  • Erkrankungen der Gebärmutter…………………………………………………………………..96
  • Uterusmyome (Fibroid)…………………………………………………………………………..96
  • Natürliche Mittel gegen Myome……………………………………………………………….. 98
  • Die allgemein übliche Therapie des Uterusmyoms ………….…………………………………100
  • Die Uterusatonie………………………………………………………………………………. 102
  • Der Gebärmuttervorfall (Unterusprolaps)…………………………………………………….. 102
  • Die eitrige Entzündung der Gebärmutter (Pyometra) …………………………………………..102
  • Die Endometriumhyperplasie…………………………………………………………………. 103
  • Der Gebärmutterkrebs ……………………………………………………….………………….104
  • Hormontherapie und Krebs ……………………………………………….…………………….107
  • Krankheiten des Gebärmutterhalses (Portio vaginalis uteri) ……….…………………………..109
  • Der Gebärmutterhalskrebs (Zervixkarzinom) …………………………………………………..110
  • Die Therapie des Zervixkarzinoms ……………………………………………………………..113
  • Allgemeines zur Chemotherapie und Radiotherapie …………………………………………...115
  • Die Vagina, die Vulva und die Clitoris …………………………………………………………118
  • Sexuelle Erregung und Geschlechtsverkehr ……………….……………………………………119
  • Die Vulva……………………………………………………………………………………… 127
  • Chronische Erkrankungen der Vulva………………………………………………………….. 129
  • Inkontinenz und Beckenbodenschwäche………………………………………………………. 131
  • Die Therapie der Beckenbodenschwäche………………………………………………………..131
  • Die Homöopathische Therapie der Inkontinenz……………………………………………….. 132
  • Die Brust……………………………………………………………………………………….. 133
  • Das Stillen ……………………………………………………………………………………….133
  • Die Muttermilch …………………………………………………………………………………136
  • Medikamente in der Stillperiode………………………………………………………………. 139
  • Erkrankungen und Fehlbildungen der Brust……………………..…………………………….. 143
  • Brustkrebs ………………………………………………………………………………………..148
  • Ursachen und Risikofaktoren…………………………...……………………………………… 148
  • Die Ernährung und das Brustkrebsrisiko…………………………………………………………150
  • Früherkennung und Screening ……………………………………………………………………150
  • Bildgebende Verfahren………………………………………………………………………..... 151
  • Die Klassifikation des Mammakarzinoms……………………………………………………..…153
  • Die Therapie des Mammakarzinoms…………………………………………………………… 157
  • Die adjuvante Therapie…………………………………………………………………………. 159
  • Schlusswort 168
  • Literaturnachweis …………………………………………………………………………………169
  • Stichwortverzeichnis ………………………………………………………………………………185

Produktinformationen zu „Bircher-Benner-Handbuch: Bd.16 Bircher-Benner Handbuch für Frauenleiden und die Wechseljahre“.

Dieses Buch ist für Frauen geschrieben, welche ihr eigenes Wesen besser verstehen möchten und nach einem Weg suchen, ihren Beschwerden in natürlicher Weise zu begegnen und diese zu heilen. Es ist auch für Männer geschrieben, die dies besser verstehen möchten. Viele Frauen leiden still und tapfer vor sich hin, mit monatlichen oder klimakterischen Beschwerden, und Krankheiten, die in natürlicher Weise vermieden und geheilt werden können, wenn man deren Ursache kennt. Die intimsten Ereignisse der Weiblichkeit, die Schwangerschaft, die Geburt und die Stillzeit sind in diesem Buch eingehend beschrieben, Zeiten in welchen Frauen grösstes Verständnis, Achtung und Respekt verdienen. Auch sind darin alle möglichen Komplikationen und Frauenkrankheiten eingehend beschrieben, mit allen Möglichkeiten, sie in natürlicher Weise zu verhüten und zu heilen. Diesem Buch liegt die neuste wissenschaftliche Evidenz zu Grunde und die jahrzehntelange Erfahrung aus der weltberühmten Bircher-Benner Klinik. Dieses Buch wird durch die Diätetik im Bircher-Benner Handbuch Nr. 15: «Für die Ernährung in der Schwangerschaft und Stillzeit», ergänzt. Für den Arzt bedeuten diese beiden Bücher eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung und Begleitung seiner Patientinnen.


Bircher-Benner Handbuch Nr. 17 Handbuch zur Verhütung und begleitenden Therapie der Krebskrankheit

Die Krebskrankheit bringt unsägliches Leid über die Menschen. Plötzlich ist etwas Unheimliches da, etwas Fremdes, das uns von innen bedroht, das vor nichts Halt macht. Man fühlt sich verlassen, hilflos, in eine übermenschliche Anstrengung versetzt, gegen das drohende Chaos anzukämpfen, das einem das Leben nehmen will und man weiss nicht, wer gewinnen wird, der Tumor oder man selbst. Was einem wichtig schien, verliert an Bedeutung. Man weiss nicht, wann man Abschied nehmen muss von allem, von denen, die man lieb hat, die uns lieb haben. Der Arzt spricht von bösartig, spricht von Prozenten einer Chance, 5 Jahre zu überleben, spricht von Operation, von Chemotherapie oder Bestrahlung, von grossen wissenschaftlichen Fortschritten und versucht zu trösten.

Der älteste Fund einer Krebsgeschwulst ist 1,6 Millionen Jahre alt. Seit der Antike kämpfen Ärzte gegen die Krebskrankheit. Die Bezeichung „Krebs“ stammt vom mittelhochdeutschen krëbez „fressendes Geschwür“. Die Bezeichung Krazinom stammt aus dem Altgriechischen: karkínos (καρκίνος) bezeichnete sowohl das Tier Krebs oder Krabbe, als auch die Krankheit selbst. Erstmals findet man diese Bezeichnung in den Werken des genialen Griechischen Arztes Hippokrates und später erklärte Galenos von Pergamon den Namen mit der Ähnlichkeit der geschwollenen Adern eines von aussen sichtbaren Brustkrebses mit den Beinen des Tieres. Im 16. Jahrhundet beschrieb Paracelsus von Hohenheim, dass die Belastung der Bergbauarbeiter mit Arsen Lungenkrebs verursacht. Rudolf Virchow begründete in der Mitte des 19. Jahrhunderts die Zellpathologie und erkannte, dass Krebs durch eine Wucherung entarteter Körperzellen entsteht. Dass Anilin und Benzidin bei Arbeitern der Farbindustrie Blasenkrebs verursachte, beschreib der Chirurge Ludwig Rehn 1895. 1924 beschrieb Ernst Kennaway, dass aromatische Kohlenwasserstoffe in Tonschieferöl, Ruß, Teer, Paraffin und Kohle Krebs erzeugen. Nach der Erfindung der Röntgenstrahlen wurde bald erkannt, dass diese Krebs erzeugen.  1920 wurde das Deutsche Krebsregister gegründet.

Die Krebskrankheit ist eine der grössten Bedrohungen der Menschheit. Nach den Statistiken der Weltgesundheitsorganisation erkranken allein in Europa jedes Jahr 4,6 Millionen Menschen an Krebs. 2,1 Millionen Menschen sterben jedes Jahr an dieser Krankheit, zu 20% an Lungenkrebs, zu 12% an Darmkrebs, zu 7% an Brustkrebs, zu 6% an Bauchspeicheldrüsenkrebs und zu 5,7% an Magenkrebs. Wir sind alle von Krebs betroffen, entweder unmittelbar oder durch die Erfahrungen von Freunden und Familienangehörigen.

Innerhalb Europas gibt es deutliche Unterschiede hinsichtlich des Risikos einer Einzelperson, im Laufe des Lebens an Krebs zu erkranken: im westlichen Europa liegt dieses Risiko bei über 25%, in den Ländern Osteuropas zwischen 19% und 25%, und in den zentralasiatischen Ländern zwischen 10% und 19%. Das Risiko an einer Krebserkrankung zu sterben liegt in den Ländern Osteuropas und Zentralasiens bei über 12%, während es in Westeuropa mit Werten zwischen 9% und 12% etwas geringer ausfälllt.

Krebs ist nicht einfach Zufall. Seit Jahrzehnten erkranken jedes Jahr immer mehr Menschen an Krebs, durch die allgemein verbreitete „zivilisierte“ Lebensweise. Krebs ist eine „Zivilisationskrankheit“. Die wichtigste Ursache liegt in der allgemein verbreiteten Fehlernährung mit viel Fleisch, Fett, Zucker und Weissmehlspeisen, industriell verkünstelter Nahrung, Rauchen, Kaffee und Alkohol und einem Mangel an lebendigen Vegetabilien mit ihrem hohen Gehalt an Krebs bekämpfenden „sekundären“ Pflanzenstoffen, Mangel an Vitaminen und an Selen und Zink durch einseitige Düngung der Böden, sowie durch unsachgemässes Sonnenbaden. Weitere Ursachen liegen in der Luftverschmutzung, in immer grösserer Verbreitung toxischer Produkte und Gase aus Verbrennungsanlagen, Strahlenbelastungen, kontaminierten Böden und immunsuppressiven Medikamenten.

Wenn immer möglich, ist die operative Entfernung des Tumors ganz wichtig, da er den Körper durch seine krankmachende Energie schwächt. Die derzeit üblichen anderen Therapien erfüllen meist nicht die Erwartungen, die man an sie stellt. Sie sind ein verständlicher Versuch, die Krebszellen durch Vergiftung oder Bestrahlung zu vernichten. Doch sind deren Resultate nicht sehr ermutigend, denn nur ein geringer Unterschied in der Empfindlichkeit der Krebszellen gegen die eingesetzten Gifte oder radioaktiven Strahlen im Vergleich zur Empfindlichkeit gesunder Gewebe, kann für eine Wirkung genutzt werden. Die Vitalität des behandelten Menschen wird so stark geschädigt, dass viele Patienten vorzeitig an den Schäden durch die Chemotherapie oder Radiotherapie sterben.

Dieses Buch ist für Menschen geschrieben, die Krebs verhüten möchten oder die an Krebs erkrankt sind und nach einem wissenschaftlich fundierten Weg suchen, ihre Vitalkraft so zu stärken, dass ihre Krankheit besiegt wird. Einst kam ein junger Arzt zu Dr. Bircher-Benner in die Klinik, mit frisch diagnostiziertem Leberzellkarzinom. Nach gründlicher Untersuchung empfahl er ihm eine reine pflanzliche Rohkostdiät, Verzicht auf Kaffee und Alkohol und tägliches Wandern.  Als er nach 4 Monaten zurückkam, war der Tumor verschwunden. Danach errichtete dieser Arzt ein Sanatorium in Arosa, wo er sein langes Leben lang vielen Menschen mit Krebs in derselben Weise helfen konnte. Ein Patient aus Deutschland war an einem multiplen Myelom erkrankt. Gleichzeitig eine Patientin aus der Schweiz. Beide kamen in unsere Klinik. Der Patient aus Deutschland hatte die Chemotherapie abgelehnt und machte reine Rohkostdiät mit ganz frisch zentrifugierten Obst- und Gemüsesäften, Mandelmilch, Nüssen und täglichem Wandern. Die Spiegel der Vitamine und Spurenelemente wurden an die obere Normgrenze gebracht. Die Patientin aus der Schweiz machte dasselbe, jedoch zusätzlich eine „leichte“ Chemotherapie, für welche sie der Onkologe hat überzeugen können. Das multiple Myelom des Patienten verschwand zwar nicht, aber es breitete sich nicht weiter aus, so dass er viele Jahre schmerzfrei blieb, bis wir ihn aus den Augen verloren haben. Die Patientin aus der Schweiz litt bald an unerträglichen Knochenschmerzen in der Wirbelsäule, wo der Tumor sich einnistete und Knochen auflöste, so dass  zwei Wirbelkörper eingebrochen waren. Die Wirbel konnten durch den Defekt füllende Injektionen von Knochenzement in der Uniklinik Bern stabilisiert werden, so dass sie wieder fast schmerzfrei gehen und sogar reiten konnte. Doch nach einigen Monaten versagte die Blutbildung im Knochenmark und entstanden äusserst schmerzhafte Blutergüsse in den Beinen und die Patientin starb an den Schäden, welche die Chemotherapie verursacht hatte. Eine 73 jährige Patientin kam in unsere Klinik, nachdem man ihr in der Universitätsklinik ein Pankreaskarzinom diagnostiziert hatte. Man gab ihr keine Hoffnung. Sie führte die Rohkostdiät ganz strikt durch. Dann setzten wir mehrere zytostatisch wirkende brasilianische Pflanzenextrakte ein und die südafrikanische Pflanze Sutherlandia fruteszens. Der Tumor vergrösserte sich stark und wurde zystisch, dann löste er sich vollständig auf. Diese Patientin verstarb 3 Jahre später an einem Herzinfarkt. Nachdem Dr. Ramakrishnan seine ganze Familie an Krebs verloren hatte, baute er in Mumbay eine Krebsambulanz mit 10 Ärzten auf, für eine rein homöopathische Krebstherapie. Er entdeckte, dass die besten Resultate erzielt werden konnten, wenn eine Nosode, ein aus Krebsgewebe potezierte Arznei gegeben wird, welche die Konsistenz des Tumors angeht und eine zweite homöopathische Arznei, die individuell nach der Persönlichkeit, der Art des Tumors und seiner Lokalisation gewählt wurde. Er entwickelte eine spezielle Methode, bei welcher die Patienten diese beiden Mittel in wöchentlichem Wechsel ungefähr jede Stunde einnahmen und deren Potenz jeden Tag gesteigert wurde. Sauber dokumentiert konnte er von vielen Krebsheilungen berichten, zum Beispiel der Heilung von Hirntumoren (Astrozytome) durch Barium carbonicum, im Wechsel mit Carcinosinum, eines Leberkarzinoms durch Lycopodium, im Wechsel mit Szirrhinum usw. .Tumoren, die metastasiert waren, konnten nicht geheilt werden, aber wenigstens konnten die Schmerzen gelindert werden.

In aller wissenschaftlichen Bescheidenheit, sind solche Therapieerfolge ernst  zu nehmen. Leider sind dies alles nur Fallberichte und gibt es keine statistischen Erhebungen dazu. Solche wissenschaftliche Arbeiten sind sehr kostenaufwändig und finanzielle Mittel fehlen. Aber sie geben berechtigten Mut, in der Krebstherapie neue Wege zu gehen, durch Therapien, welche Krebs bekämpfen, indem sie die Abwehrfähigkeit des Körpers massiv stärken.

Auf die Beschreibung der einzelnen Arten von Krebs haben wir bewusst verzichtet, da sich die in diesem Buch beschrieben Therapien gegen alle Tumorarten eignet.

Dieses Buch vermittelt eine ganz andere, umfassendere Sicht der Krebskrankheit. Die beschriebene Therapie zur Verhütung von Krebs und zu dessen ergänzenden Bekämpfung, basiert auf wissenschaftlicher Evidenz. Wie Krebs entsteht, wie man ihn verhüten und bekämpfen kann ist in diesem Buch eingehend erklärt, bereit zur praktischen Anwendung. Für den behandelnden Arzt bedeutet dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung und Begleitung seiner Patienten.

 

Inhalt

Vorwort

Wie Krebs entsteht

Die Ursachen der Krebkrankheit

       Genetische Ursachen

            Vererbte Tumorarten

            physikalische Ursachen für Krebs

                   Aflatoxine

                   Alkohol

                   Asbest

                   Benzol, Benzin und Dieselöl

                   Geschlechtshormone: Östrogene und Gestagene

                   Polyzyklische aromatische Kohlenwasserstoffe (PAK). Grillieren von Fleisch

                   Schwermetalle

                      Arsen

                      Cadmium

                      Chrom und Nickel

                   Radon als Ursache von Krebs

                   Übertriebene Sonnenbestrahlung als Ursache von Krebs

                      Der Schwarze Hautkrebs

                        Vererbung als Teilursache des malignen Melanoms

                        Die Stadien der Ausbreitung des malignen Melanoms

                        Die allgemein übliche Therapie des malignen Melanoms

                             Palliative Therapien

                             Versuche das Tumorwachsutm zu  hemmen

                             Krebsimmuntherapie

                             Das Melanokarzinom und die Ernährung

       Infektionen als Krebsursache

       Ernährung und Krebs

       Geopathische Teilursachen

       Mibilfunkstrahlung, DECT-Telefone, WLAN und Krebs

       Präkanzerosen

            Fakutative Präkanzerosen

            Obligate Präkanzerosen

Chemotherapie und Radiotherapie

Immuntherapie gegen Krebs

Gegen Krebs wirksame Heilpflanzen

Die Ordnungstherapie zur Verhütung und Behandlung von Krebs

       Das Beheben und Vermeiden der Ursachen

       Die diätetische Therapie

            Das Problem der Nahrungsenergie

            Zweierlei Nahrungsenergie

            Das Grundregulationssystem des zarten Bindegewebes (Matrix)

            Oxydativer Stress im Zentrum der degenerativen Krankheiten, Demenz und Krebs

            Das Integralgesetz der Nahrung

            Die Lebendigkeit der Nahrung

            Die Bedeutung der Nahrungsökonomie

            Sekundäre Pflanzenstoffe (Phytochemicals)

            Nahrungsmittel gegen Krebs

            Nahrungsmittel zur Bekämpfung von Infektionskrankheiten

            Nahrungsmittel zur Kräftigung und Modulation des Immunsystems

       Die Lebensordnung

       Die antioxydative Therapie

       Die Phytotherapie gegen Krebs

       Die homöopathische Krebstherapie

Die Durchführung der Diät

Die Diät mit lebendiger vegetabiler Frischkost (Rohkost)

       Die Indikation zur Diät mit vegetabiler Frischkost (Rohkost)

       Die Diätstufe I

            Die Heilkrise

            Vereinfachter Menuplan für die Diätstufe I

                   Vollsafttag

       Die Diätstufe II

       Formen vegetabiler Frischost (Tabelle)

       Reaktionen auf die Umstellung auf die vegetabile Frischkost und ihre Behandlung

       Begleitende allgemeine Empfehlungen zur vegetabilen Frischkost           

       Die neue Gleichgewichtslage

       Die verjüngende Wirkung der vitalen vegetabilen Frischkost

       Die richtige Anfangsdosierung

       Das Thema der so genannten „Rohkostintoleranz“

       Empfehlung für die Laboruntersuchungen für den behandelnden Arzt

       Die Zubereitung und Reinigung der Rohkost

            Die Frische

            Die Qualität

            Die Zusammenstellung der Rohkost

            Die Anpassung an den Geschmack und die Kaufähigkeit

                   Die unzerkleinerte Zubereitung

                   Die normale Zerkleinerung

                   Die stärkere Zerkleinerung (fein gehackt)

                   Die pürierte Zubereitung

            Die Reinigung der Rohkost

       Von der Bircher-Raffel zur elektrischen Küchenmaschine

       Küchengeräte für einen kleinen Haushalt

       Für Grossküchen, in Sanatorien. Spitälern und Kurhäusern

Speisezettel

       Frischsaftfasten

       Die Dauer der Frischsaftdiät

       Früchtefastentage

       Rohkostmenus für jede Jahreszeit

       Tagesmenu

       Rohkosttag mit Zulage

       Gemüsebrühe als Zulage

       Backkartoffeln als Zulage (Diätstufe III)

       Übergangskost zur Diätstufe III

Die Rezepte

       Rezepte für die Diätstufen I und II

            Birchermüesli

            Gekeimte Getreidekörner

            Früchte-Frischkorn-Speisen

            Frischsäfte

            Milcharten

            Saucen zu Rohgemüse

            Salatgerichte und passende Saucen (Tabelle)

            Rohgemüse gemischt (Tabelle)

            Rohgemüse püriert (Tabelle)

            Gesundheitstees

       Rezepte für die Diätstufe III und IV*

            Suppen

            Gemüse

            Salate von gekochten Gemüsen

            Kartoffelgerichte

            Getreidespeisen

            Saucen

            Belegte Brötchen

            Früchtespeisen, gesunde Desserts

       Die Wirkung verschiedener Nahrungsmittel gegen Krebs, Infektionen und Immunschwäche (Tabelle)

       Rezeptverzeichnis

       Literaturverzeichnis

       Stichwortverzeichnis

Handbuch Nr. 17: „Zur Verhütung und ergänzenden Therapie der Krebskrankheit“ 1. Auflage.

Krebs ist das grösste Chaos, das in uns entstehen kann. Trotz des bald untragbar gewordenen Aufwandes im „Gesundheitswesen“ ist die Krebskrankheit jedes Jahr häufiger geworden. In „zivilisierten“ Ländern erkrankt heute jeder Vierte irgendwann in seinem Leben an Krebs. Krebs ist kein Zufall. Doch sind die Ursachen den meisten Menschen nicht bekannt. Viele lassen sich vermeiden, so man sie kennt. Darum sind sie in diesem Buch eingehend beschrieben. Ist man an Krebs erkrankt, so beginnt ein übermenschlicher Kampf gegen das Chaos, das in uns am Entstehen ist: eine Kampf zwischen dem Krebs und uns selbst, unserer Lebenskraft, unserem Immunsystem, unserem ganzen Sein. Unser Körper ist mit wunderbaren, hoch effizienten Möglichkeiten ausgestattet, um die Mutationen, die täglich in uns entstehen, zu reparieren. Damit ein Krebs entsteht, sind immer mehrere Mutationen notwendig und nur wenn diese zufällig Gene treffen, welche einer Zelle die Eigenschaften verleihen, sich unkontrolliert zu vermehren, sich für das Immunsystem unsichtbar zu machen, in fremdes Gewebe einzudringen, wo sie nichts zu suchen hat und sich eine eigene Blutversorgung zu verschaffen, entsteht Krebs. Mit seiner chaotischen Energie will er uns beherrschen. Darum muss er so weit als möglich operativ entfernt werden. Gelingt dies nur teilweise, so geht der Kampf weiter. Die Chemotherapie ist ein Versuch, den Krebs stärker zu vergiften, als uns selbst. Oft wirkt das anfangs, dann ist unser Immunsystem, unsere Lebenskraft, die sich mit übermenschlicher Anstrengung gegen den Krebs wehren muss, derart geschwächt, dass der Krebs überhandnimmt. Nicht anders wirkt die Radiotherapie. Das Paradigma der Onkologie hat das Augenmerk fast ausschliesslich auf diese Vernichtungsversuche gerichtet. Dadurch ist es an seine Grenzen gestossen. Die Krebstherapie muss ergänzt werden durch einen anderen Weg, der die Heilungskraft konsequent und in höchstem Mass unterstützt, damit der Krebs besiegt werden kann. Dieser Weg ist in diesem Buch beschrieben und zwar auf wissenschaftlicher Grundlage und mit praktischer Anleitung und Rezepten, so dass man ihn gehen kann: ein Weg, der sich lohnt. Für den behandelnden Arzt bedeutet dieses Buch eine wertvolle Hilfe bei der Führung und Begleitung seiner Patienten und eine grosse Zeitersparnis.


Bircher-Benner: (Hand)buch Nr.18 für Kopfschmerzen und Migräne

10-14 % der Weltbevölkerung leiden an Migräneanfällen, Frauen dreimal häufiger als Männer. In Deutschland leiden 8 Millionen Menschen an Migräne. In anderen europäischen Ländern und den USA ist die Situation nicht anders. Im letzten Jahr der Grundschule klagen bis zu 80% der Kinder über Kopfschmerzen und zu 15% wird Migräne diagnostiziert. In der Pubertät ist jedes 5. Kind migränekrank, Knaben gleich häufig wie Mädchen. Nach der Geschlechtsreife sind Frauen dreimal häufiger betroffen, oft mit periodenabhängigen Anfällen. 

Noch gilt die Migräne offiziell als neurologisches Leiden. Noch wird sie ausschliesslich medikamentös behandelt, mit dem verständlichen Versuch, die Symptome zu unterdrücken. Dies ist mit erheblichen Risiken und teils sehr gefährlichen Nebenwirkungen verbunden. Die Medikamente behandeln nicht die Ursache. Darum wird das Leiden chronisch. 

Vor vielen Jahren hat Maximilian Bircher-Benner erkannt, dass die Migräneanfälle durch eine Notregulation des Stoffwechsels zustande kommen, durch eine gewaltige, periodische Entladung eines massiv überlasteten und vergifteten Stoffwechsels. Seither wurden in der bekannten Bircher-Benner Klinik, heute Medizinisches Zentrum Bircher-Benner, viele hundert Menschen von ihren Migräneanfällen befreit, durch konsequentes angehen der Ursachen. Immer mehr bestätigt die neue Migräneforschung Vergiftung und Überlastung des Stoffwechsels als Ursache. Migräne ist zuverlässig heilbar, wenn man nicht das Symptom, sondern die Ursachen konsequent angeht. Auch beim Cluster-Kopfschmerz und den anderen Kopfschmerzformen ist diese Therapie von grosser Hilfe. 

Dieses Buch aus einem Zentrum modernster Heilkunst beruht auf den neuesten wissenschaftlichen Erkenntnissen und jahrzehntelanger Erfahrung. Eingehend und in gut verständlicher Weise erklärt es die Ursachen der Migräne und der anderen Kopfschmerzformen. Jedem an Kopfschmerzen leidenden Menschen gibt es das notwendige Wissen in die Hand für den Weg zu einer dauerhaften Heilung, ein Weg, der sich lohnt. Für den Arzt ist es eine grosse Hilfe und Zeitersparnis bei der Führung seines Patienten.

Inhaltsverzeichnis:

  • Vielerlei Kopfschmerzen, vielerlei Ursachen
  • Kopfschmerz durch Stoffwechselüberlastung
  • Kopfschmerz durch hohen Blutdruck
  • Die Arteriosklerose
  • Kopfschmerz des herzkranken Menschen
  • Störungen der Leberfunktion
  • Ein kranker Magen-Darmtrakt
  • Ungewöhnliche Befunde als Kopfschmerzursache
  • Kopfschmerz durch Entzündungen des Dünndarms
  • Kopfschmerz durch den kranken Dickdarm
  • Kopfschmerz bei chronischen Nierenkrankheiten
  • Die Hirnhautentzündung
  • Geisteskrankheiten
  • Seelische Leiden, Erschöpfung, Trauer, Überforderung, Verstimmungen oder überfordernde Denkarbeit
  • Der Schwermütige
  • Hitzschlag und Sonnenstich
  • Unfälle und Hirnerschütterung
  • Infektionskrankheiten
  • Kopfschmerzen entstehen nicht selten durch die Augen
  • Der Nackenschmerz
  • Der neuralgische Kopfschmerz
  • Die Gürtelrose
  • Der Kopfschmerz bei Allergie
  • Zwei Beispiele von Kopfschmerzpatienten
  • Der Clusterkopfschmerz¨
  • Epidemiologie des Clusterkopfschmerzes
  • Ursachen des Clusterkopfschmerzes 
  • Die Diagnose des Clusterkopfschmerzes
  • Auslösende Faktoren
  • Die Therapie des akuten Anfalls
  • Die medikamentöse Therapie zur Vorbeugung der Anfälle
  • Komplementärmedizinische Therapie des Clusterkopfschmerzes
  • Die Ordnungstherapie des Clusterkopfschmerzes
  • Die Migräne
  • Der Stoffwechsel und das vegetative System
  • Der Typus des Menschen mit Migräne
  • Migräneäquivalente Krampfkrankheiten
  • Die Lebensgeschichte des Migränepatienten
  • Frühfall und Spätfall der Migräne
  • Herdinfektion und Allergie
  • Der intestinale Herd
  • Erscheinungsformen und Arten der Migräne
  • Die Vorbotenphase
  • Die Aura
  • Die Kopfschmerzphase
  • Die Phase der Rückbildung
  • Die Migräne ohne Aura
  • Die familiäre hemiplegische Migräne
  • Die sporadische hemiplegische Migräne
  • Die Basilarismigräne
  • Die vestibuläre Migräne
  • Die retinale Migräne
  • Die periodenabhängige Migräne
  • Die chronische Migräne
  • Der Status migränosus
  • Der Migräneinfarkt
  • Die Migralepsie
  • Visual snow (Schneesehen)
  • Epidemiologie der Migräne
  • Die Diagnose der Migräne
  • Wissenschaftliche Untersuchungen zur Ursache der Migräne
  • Die vaskuläre Hypothese
  • Die Übererregbarkeitshypothese
  • Vererbung
  • Die Hypothese der Stoffwechselvergiftung als Ursache der Migräne
  • Stoffwechsel und Migräne aus heutiger Sicht
  • Nahrungsmittelallergien und Unverträglichkeiten und Migräne
  • Der Einfluss eines kranken Darmes auf das Gehirn, die «Gut-Brain-Axis»
  • Schwermetallvergiftung und Migräne
  • Schlafmangel als Teilursache der Migräne
  • Studien zu den auslösenden Faktoren des Migräneanfalls
  • Die offizielle medikamentöse Therapie der Migräne
  • Die medikamentöse Akuttherapie des Migräneanfalls
  • Die Triptane
  • Mutterkornalkaloide
  • Antiemetika
  • Antiepileptika
  • Kortikoide
  • Opium-Alkaloide und andere Schmerzmittel
  • Die offizielle medikamentöse Intervalltherapie
  • Betablocker
  • Calciumantagonisten
  • Antiepileptika
  • Monoklonale Antikörper
  • Antidepressiva
  • Naproxen
  • Weitere Medikamente dritter Wahl
  • Pflanzliche Mittel zur Intervalltherapie
  • Nahrungsergänzungsmittel, Magnesium
  • Die medikamentöse Therapie im Kindesalter
  • Die homöopathische Therapie des Migräneanfalls
  • Primär- und Sekundärwirkung
  • Die Gate-Control Theorie
  • Die Akupunktur
  • Die transkutane elektrische Nervenstimulation (TENS)
  • Die progressive Muskelentspannung nach Jacobsen
  • Die Bindegewebsmassage
  • Das autogene Training
  • Die Neuraltherapie nach Huneke
  • Die non-invasive Nervus Vagus Stimulation
  • Die Ordnungstherapie zur Verhütung und Heilung der Migräne
  • Die diätetische Therapie
  • Zeitordnung, Bewegung, Ruhe, Wasseranwendungen
  • Medikamente während der Ursachentherapie
  • Die seelische Behandlung des Migränepatienten
  • Was im Migräneanfall zu tun ist
  • Einige Beispiele zur Therapie der Migräne
  • Die Verhütung der Migräne
  • Speisezettel
  • Teefasten und Frischsäftefasten
  • Früchtetage
  • Besondere Früchtefasten-Formen
  • Beispiele für den wöchentlichen Rohkosttag
  • Einteilung des Rohkost-Speisezettels nach jeweiliger Saison
  • Einkostnahrung
  • Heildiät für Migränepatienten, Speisezettel für die Dauerkost
  • Fettarme Diät (bei Migränepatienten als Dauerkost)
  • Fettlose Diät (bei Migränepatienten und Leber-Gallenerkrankungen)
  • Diät bei Verstopfung
  • Diät bei Durchfall
  • Vegane Diät (Allergiker mit Migräne)
  • Salzlose Diät (für Kopfwehpatienten mit Nierenleiden und bei erwünschter 
  • Entwässerung)
  • Rezepte
  • Säfte
  • Fruchtsäfte
  • Gemüsesäfte
  • Kartoffelsaft
  • Schleim als Zusatz zu Säften
  • Gesundheitstees
  • Birchermüesli
  • Rohgemüse und Salate
  • Salatsaucen
  • Zum Rohgenuss geeignete Gemüse und die dazu passenden Kräuter und Saucen
  • Milcharten
  • Butter, Pflanzenfette und Öle, schonendes Kochen und Dämpfen
  • Eier
  • Quark- und Käsegerichte
  • Suppen
  • Gemüse
  • Salate von gekochten Gemüsen
  • Kartoffelgerichte
  • Getreidespeisen
  • Belegte Brötchen
  • Saucen
  • Desserts
  • Hydrotherapie und Nackengymnastik
  • Rezeptverzeichnis
  • Literaturnachweis
  • Stichwortverzeichnis

Handbuch für Kopfschmerzen und Migräne: 
Diesem Handbuch liegt das Wissen und die jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Bircher-Benner: (Hand)buch Nr.19 für Bluthochdruck, Herz- und Arteriosklerosekranke

Diätanleitungen zur Verhütung und Heilung mit Rezeptteil, eingehende Ratschläge und ausgearbeiteter Kurplan aus einem ärztlichen Zentrum modernster Heilkunst.

Diesem Handbuch liegt ein großes Erfahrungsgut zu Grunde in der Behandlung von Menschen, die an Herz- und Kreislaufkrankheiten litten und – so dies noch möglich war – durch die BircherBennersche Ordnungstherapie Heilung fanden. Die früheren Auflagen wurden durch viele Hinweise und Erkenntnisse aus der klinischen, epidemiologischen und der Grundlagenforschung ergänzt. Auch der diätetische Teil wurde sanft überarbeitet, ohne dass die hohe Qualität der Bircherschen Rezeptkunst verloren ging. Dieses Buch gibt denjenigen Menschen das nötige Wissen und die unentbehrliche praktische Anleitung in die Hand, die bereit sind, die frühen Zeichen und Risikofaktoren der Herz- und Kreislauferkrankung ernst zu nehmen und wissen wollen, wie sie aus dieser Krankheitsentwicklung herausfinden können, um dem Drama schwerer Behinderung oder des Todes durch einen Herzinfarkt oder Hirnschlag zu entgehen.

Seit Dr. Maximilian Oscar Bircher-Benner wurde während über hundert Jahren an der Bircher-Benner-Klinik selbst und in privaten Arztpraxen die Ordnungstherapie der Herz-Kreislaufkrankheiten in sorgsamer Beobachtung der Heilungswirkungen erforscht. In all diesen Jahren waren die vielen tausend Patientinnen und Patienten, die aus ihrer Krankheitsentwicklung herausfanden, unsere größten Lehrmeiser. Mit starkem Willen zur Heilung führten sie die Anweisungen der Ordnungstherapie erfolgreich durch und ermöglichten so die großen Erkenntnisse, deren Bestätigung sich erst jetzt allmählich auch in der allgemeinen medizinischen Forschung zeigt. Unsere Erfahrung, dass der Bluthochdruck durch unsere Diät rückbildungsfähig ist und dass die Arteriosklerose auch in den Herzkranzgefäßen durch eine langzeitige und sorgsame Anwendung unserer Diät rückbildungsfähig ist, ist nun seit gut 2 Jahr zehnten wissenschaftlich einwandfrei belegt.

In der Neuordnung der Lebensweise hat die Ernährung eine erstrangige Bedeutung. Sie führt zu einer Regeneration der großen Regulationssysteme, zu einer neuen Öffnung zur Außenwelt hin und zu sich selbst, die erst das Ingangkommen der Heilungskräfte des Organismus, des Körpers und der Seele, möglich werden lässt. Zitiert sei hier eine Stelle aus Bircher-Benners Schrift „Vom Werden des neuen Arztes“: „Die Wunder der Seele bleiben jenen verschlossen, die dauernd die Ernährungsgesetze missachten. Von der Ernährung hängen Kraft und Tiefe der inneren Erlebnisse ab – das ist ihre eigentliche Bedeutung. Sich um seinen Körper, um seine Ernährung zu kümmern, hat keinen Zweck, es sei denn, dass daraus eine neue Entfaltung, ein Erwachen innerer Kräfte entstehe.“

Gerade bei den Kreislaufkrankheiten hat die ganze weitere Lebensordnung große Bedeutung. Wirkliche Heilung ist nicht möglich, ohne eine grundlegende Vertiefung des Bewusstseins über den Sinn des Lebens, über die Ordnungen des Lebens, über die Beziehung zur Arbeit, zur Gesellschaft, zu sich selbst und zu den Menschen, mit denen wir leben. Am Anfang dieses Weges zur Heilung steht eine große Frage der Verantwortung den Mitmenschen und sich selbst gegenüber: ein Weg, der sich lohnt.

Für den behandelnden Arzt ist dieses Buch eine große Hilfe bei der Anleitung und Begleitung seines Patienten.
Dr. med. Andres Bircher

Inhalt:

  • Vorwort zur 17. Auflage..8
  • Einleitung..10
  • Das gesunde Herz, ein erstaunliches Organ..13
  • Das Herz und seine Aufgaben..13
  • Der Körperkreislauf..14
  • Der Lungenkreislauf..15
  • Die Kapillaren und die Grundsubstanz des zarten Bindegewebes..15
  • Degeneration und Regeneration. Die Antiquiertheit der Kalorienrechnung..16
  • Die Arteriosklerose, eine Volkskrankheit..18
  • Die Risikofaktoren für kardiovaskuläre Krankheiten..19
  • Das Problem geringer Alkoholmengen..19
  • Oxydativer Stress, eine wichtige Mitursache..21
  • Was ist Arteriosklerose eigentlich genau, wie entsteht sie?..22
  • Die Bedeutung des Fettstoffwechsels, der Adipositas und des Cholesterins..23
  • Die Bedeutung der Fettsäuren..27
  • Gesättigte Fettsäuren..27
  • Ungesättigte Fettsäuren..27
  • Einfach ungesättigte Fettsäuren..27
  • Mehrfach ungesättigte Fettsäuren..28
  • Die pharmakologische Wirkung der Omega-6-und Omega-3-Fettsäuren..29
  • Das geeignete Verhältnis der mehrfach ungesättigten Fettsäuren zueinander..29
  • Das Risiko der Oxidation der hochungesättigten Öle..30
  • Das Problem von Pflanzenmargarinen, Rahm und Butter..30
  • Die Bedeutung des Cholesterins..31
  • Der Cholesterinstoffwechsel..31
  • Die Wirkung der Ernährung auf die Cholesterinspiegel im Blut..32
  • Cholesterinstoffwechselstörung und Gallensteine..34
  • Cholesterin und die Koronare Herzkrankheit..34
  • Die Bedeutung der Eiweissstoffe und die Amyloidose..39
  • Die Bedeutung der Kohlenhydrate und des Zuckers für die Arteriosklerose..40
  • Die Bedeutung der vegetabilen Nahrung zur Verhütung der koronaren
  • Herzkrankheit..42
  • Die Wirkung von Mandeln und Nüssen gegen die Arteriosklerose..42
  • Die Bedeutung von Obst und Gemüse gegen die Arteriosklerose..43
  • Die antioxydative Wirkung der pflanzlichen Rohkost, die grosse Bedeutung der so genannten sekundären Pflanzenstoffe..43
  • Die Bedeutung der Vollkorngetreide..44
  • Die Bircher-Bennersche Heildiät und Ordnungstherapie..45
  • Der Bluthochdruck (Hypertonie)..48
  • Die Regulation des Blutdrucks..51
  • Die pulmonale Hypertonie..53
  • Die medikamentöse Therapie der Hypertonie..54
  • Die Angina pectoris..58
  • Die stabile Angina pectoris..58
  • Die instabile Angina pectoris..58
  • Die Verhütung und Therapie des Herzinfarkts..59
  • Die Angina pectoris..58
  • Die stabile Angina pectoris..58
  • Die instabile Angina pectoris
  • Die Verhütung und Therapie des Herzinfarkts..59
  • Der Herzinfarkt..60
  • Die Risikofaktoren für einen Herzinfarkt..61
  • Die Betreuung eines Menschen mit Herzinfakrt..61
  • Komplikationen des Herzinfakts..61
  • Die Verhütung des Herzinfarkts..62
  • Die Herzinsuffizienz oder das chronische Herzversagen..63
  • Die diätetische Therapie der Herzinsuffizienz..63
  • Die Herzklappenfehler..64
  • Die Mitralklappenstenose..65
  • Die Mitralklappeninsuffizienz..66
  • Die Aortenklappenstenose..67
  • Die Aortenklappeninsuffizienz..68
  • Die Pulmonalklappenstenose..69
  • Die Tricuspidalklappeninsuffizienz..69
  • Entzündliche Krankheiten des Herzens..71
  • Die Herzmuskelentzündung (Myocarditis)..71
  • Toxische Herzmuskelschäden..71
  • Autoimmunentzündungen des Herzens..71
  • Die Symptome der Herzmuskelentzündung, Therapie und Prognose..71
  • Die Endokarditis..71
  • Das Aneurymsa..73
  • Das Aneurysma dissecans der Aorta..73
  • Aneurysmen der Hirnschlagadern..73
  • Der Schlaganfall (Apoplexie)…74
  • Die Nierenarterienstendose..76
  • Die Karotinsstenose..77
  • Die periphere arterielle Verschlusskrankheit (PAVK)..78
  • Herzrhythmusstörungen..79
  • Supraventriukläre Extrasystolen..80
  • Ventrikuläre Extrasystolen..80
  • Vorhofflattern und Vorhofflimmern (absolute Arrhythmie)..80
  • Die Tachykardie..82
  • Entzündungen der Arterien..84
  • Die Vaskulitis..84
  • Regulative Therapien der Naturheilkund für Herz-und Kreisklaufkranke..87
  • Klimatherapie und Terrainkuren..87
  • Die Hydrotherapie..87
  • Die klassisch homöopathische Therapie..88
  • Die neue wissenschaftliche Akupunktur..89
  • Die Neuraltherapie..90
  • Allgemeine Richtlinie zur Behandlung und Verhütung der Arteriosklerose
  • Und der Herz-Kreislaufkrankheiten..91
  • Die Heildiät..93
  • Sekundäre Pflanzenstoffe..100
  • Speisezettel..102
  • Menü-Zusammenstellungen bei verschiedenen Rohkost-Diätformen..102
  • 1. Frischsaftfasten (Bett-Safttag)..102
  • 2.Vollsaft-Tag..102
  • 3. Früchte-Fasttage..102
  • 4. Rohkost-Menüs (für die Diätstufe 2)..104
  • Tagesmenu..104
  • Tabelle zur Rohkostdiät..106
  • Die Rezepte..107
  • Fruchtsäfte..107
  • Gemüsesäfte..108
  • Kartoffelsäfte..108
  • Schleim als Zusatz zu Säften..108
  • Birchermüesli..108
  • Gekeimte Getreidekörner..110
  • Rohgemüse und Salate..111
  • Salatsaucen…112
  • Tabelle zur Wahl geeigneter Salatsaucen…115
  • Milcharten..116
  • Pflanzenfette, Öle und Butter…116
  • Schonendes Kochen und Dämpfen..117
  • Suppen..117
  • Gemüse..121
  • Salate von gekochten Gemüsen..126
  • Kartoffelgerichte..127
  • Getreidespeisen..129
  • Saucen..132
  • Belegte Brötchen..135
  • Desserts..135
  • Gesundheits-Tees..139
  • Rezeptverzeichis..141
  • Literaturnachweis..144
  • Sachregister..152

Handbuch für Bluthochdruck,Herz- und Arteriosklerosekranke: Diesem Handbuch liegt das Wissen und die jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Bircher-Benner: (Hand)buch Nr.21 für Hautkranke udn Hautempfindliche

Eine schöne Haut zu haben ist nicht nur eine Frage der Ästhetik. Sie ist in erster Linie eine Frage der Gesundheit. Es gibt keine reine Hautkrankheit. Immer ist es in erster Linie eine innere Erkrankung des gesamten Organismus, die sich in der Haut ausdrückt. Nur bei ganz wenigen Hautkrankheiten fand man eine vererbte Komponente, doch haben neuere Forschungen ergeben, dass es - mit Ausnahme des Hautkrebses -  sich um eine epigenetische Vererbung handelt. Dies bedeutet, dass keine Mutation vorliegt, sondern dass nur eine veränderte Aktivität (Expressivität) der Gene weitervererbt wird. Die Aktivität unserer Gene wird durch die Ernährungs- und Lebensweise, durch Toxine und Umweltfaktoren beeinflusst, im Besonderen durch Behandlungen, die dazu angetan sind, die Symptome und das Immunsystem zu unterdrücken. In früheren Jahrhunderten geschah dies oft mit Quecksilber- und Schwefelhaltigen Zubereitungen alchimistisch geschulter Apotheker. Die Neurodermitis gleicht der Krätzmilbenkrankheit, nur dass man keine Milben findet und die Psoriasis gleicht einer Pilzinfektion, ohne möglichen Pilznachweis und wurde früher oft mit Lepra verwechselt, mit dramatischen Folgen für die Betroffenen. Die neue dermatologische Wissenschaft hat die grosse Bedeutung eines kranken Milieus im Darm mit krankhaft verändertem Mikrobiom (Darmflora) entdeckt, welche die Autoimmunität und die allergische Teilursache mehrere Hautkrankheiten erklärt, so bei der Psoriasis, der Sklerodermie, der Rosazea, der Vitiligo, der Neurodermitis u.a.. Die Wissenschaftler sprechen heute von einer „Darm-Haut-Achse“, da man festgestellt hat, dass die Gene der Mikroben genauso wie unsere eigenen Gene auf uns einwirken. Man hat bei verschiedenen Krankheiten festgestellt, dass typische Veränderungen der Populationen des Mikrobioms vorliegen und dass diese Krankheiten durch dessen Korrektur gebessert werden können. Bei allen Hautkrankheiten, besonders dem atopischen Ekzem (Neurodermitis), der Schuppenflechte (Psoriasis), der Akne, der Rosazea, der Vitiligo, der Sklerodermie ist die Heilung der inneren Krankheit im Magen-Darmtrakt, im enteralen Immunsystem, im Stoffwechsel, die Therapie der Ursache und die einzige, aber eine wunderbare Möglichkeit, diese Krankheiten, die offiziell noch immer als unheilbar angesehen werden, dauerhaft zu heilen. Auch bei den infektiösen Hautkrankheiten und den verschiedenen Arten von Hautkrebs ist die innere Therapie durch eine Genesung des durch Fehlernährung und Toxine krankhaft geschwächten Immunsystems für deren Verhütung und Heilung entscheidend. In diesem Handbuch werden die Ursachen der Hautkrankheiten sorgsam aufgezeigt, werden die verschiedenen offiziell angewandten, meist bloss symptomunterdrückenden Therapieformen erklärt, damit es dem Leser möglich wird, diese zu beurteilen. Dieses Buch richtet sich an Patienten, welche eine definitive Heilung ihrer Hautkrankheit  suchen, durch eine Therapie der Ursachen. Dieser Weg ist für jede Art der Erkrankung sorgsam und gut verständlich aufgezeigt, mit praktischer Anleitung, Diätplänen und köstlich schmeckenden Rezepten. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe  bei der Führung seiner Patienten.

Inhalt:

  • Vorwort
  • Die Haut, der Spiegel der Gesundheit
  • Der Aufbau der Haut
  • Die Innervation der Haut, das Wunder der Sensibilität
  • Cutiviscerale Reflexe und Dermatome
  • Die Atmung durch die Haut
  • Schweissdrüsen und Talgdrüsen
  • Die Bakterienflora der Haut
  • Der Einfluss des Darmes und seines Mikrobioms auf die Haut
  • Das Immunsystem der Haut
  • Die trockene Haut
  • Das Immunsystem der Haut
  • Infektionskrankheiten der Haut
  •      Bakterielle Infektionen
  •             Die Akne
  •             Die Akne rosacea
  •             Furunkel
  • Die Pyodermie
  • Die Borreliose
  • Atherome
  • Die Hauttuberkulose  
  • Viruskrankheiten der Haut
  •           Herpes simplex
  •           Molluscum contagiosum
  •           Varicellen
  •           Herpes zoster
  •           Masern
  •           Röteln
  •           Ringelröteln
  • Pilzinfektionen der Haut
  •           Candida albicans
  •           Hautmykosen
  • Hautkrankheiten mit unklarer Ursache
  • Krampfadern und venöse Geschwüre
  • Die Neurodermitis
  •      Das Wesen der Neurodermitis
  •      Die Ursachen der Neurodermitis
  •           Epigenetische Vererbung, Atopie
  •           Ernährung
  •           Toxine und Schermetalle
  •           Das Milieu im Darm und die Darmflora
  •           Neurodermitis und Infektion
  •           Nahrungsmittelunverträglichkeiten
  •           Seelische Einflüsse
  •           Die Therapie der Neurodermitis
  •           Die offizielle Therapie, Medikamente und Salben      
  •           Die Infusionstherapie zur Umstimmung des vegetativen Nervensystems
  •           Die Ordnungstherapie und diätetische Therapie der Neurodermitis
  •               Mikrobielle Therapie und Symbioselenkung
  •               Die Bedeutung der homöopathischen Therapie      
  •               Die Heildiät
  •               Die Besonnung der Haut
  •               Wasseranwendungen und Trockenbürsten
  •               Die Lebensordnung
  •               Die Pflege der Haut
  • Die Schuppenflechte (Psoriasis vulgaris)
  •      Das Wesen der Schuppenflechte
  •      Ursachen der Psoriasis
  •           Ernährung und Psoriasis
  •           Epigenetische Vererbung
  •           Autoimmunität
  •           Die Bedeutung des Milieus im Darm und des Mikrobioms
  •           Schwermetalle und andere Toxine
  •           Seelische Ursachen
  •      Die Therapie der Psoriasis
  •           Die Diät
  •           Die Sanierung des enteralen Milieus und des Stoffwechsels
  •           Heliotherapie und Badekuren
  •           Die Bedeutung der homöopathischen Therapie
  • Allergische Reaktionen der Haut
  •      Kontaktekzeme
  •      Das Nesselfieber (Urticaria)
  •      Reaktionen auf Medikamente
  • Angeborene Hautkrankheiten
  • Pigmentstörungen der Haut
  •      Die Vitiligo
  •      Pigmentflecken
  •      Die aktinische Keratose
  •      Seltene Hautkrankheiten
  • Tumorkrankheiten der Haut
  •      Gutartige Tumoren
  •           Warzen und Fibrome
  •           Leberflecken
  •           Hämangiome
  •           Lipome
  • Hautkrebs
  •      Sonnenbestrahlung und Hautkrebs
  •      Die Bedeutung der Ernährung
  •      Das Basaliom
  •      Das maligne Melanom
  •      Das Spinaliom
  •      Seltene Tumoren
  • Die Diät bei Hautkrankheiten
  • Die Infusionstherapie
  • Die Durchführung der Diät
  • Kurplan für eine Woche
  • Kurplan für ein Jahr
  • Allgemeine Regeln für die erste Woche
  • Allgemeine Ratschläge für ein Jahr nach Abschluss der Kur
  • Grundformen der Diät bei Hautkrankheiten
  • Verschiedene Diätstufen (Tabelle)
  • Wasseranwendungen, Lichtbad, Trockenbürsten
  • Nahrungswerte von Gemüse und Obst nach Nährgehalt
  • Speisezettel
  •    Die strenge Magerkost
  •    Die mildere Magerkost
  •    Anreicherung der Kost bei Untergewicht
  • Eine Woche für jeden Monat des Jahres
  • Eine Woche strenge Diät
  • Diätrezepte
  •    Frischsäfte
  •    Birchermüesli
  •    Rohgemüse
  •       Frische, Qualität, harmonische Zusammenstellung, Reinigung, Zubereitung
  •    Salatsaucen
  •    Milcharten
  •    Butter, Reform-Pflanzenfett und Öle
  •    Suppen
  •    Die gekochten Gemüse
  •    Salate von gekochten Gemüsen
  •    Belegte Brote
  •    Kartoffelgerichte
  •    Getreidespeisen
  •    Saucen
  •    Süssspeisen
  •    Gesundheitstees
  •    Getränke
  • Gymnastische Übungen zur Erhaltung der schlanken Linie
  • Anhang und Tabellen zur Diät bei Gewichtsproblemen
  •    Berechnete Tagesmenüs für die Diät
  •       Bircher-Vollwertkost 1200 Kaloriendiät
  •       Bircher-Vollwertkost 1600 Kaloriendiät
  •       Bircher-Vollwertkost 2100 Kaloriendiät
  •       Rohkost 1200 Kaloriendiät
  •       Rohkost 1900 Kaloriendiät
  •    Tabellen zur Zusammensetzung der gebräuchlichen Nahrungsmittel
  • Epidemiologie der Adipositas und Anorexie
  • Tabelle zum glykämischen Index und zur glykämischen Ladung der Nahrungsmittel
  • Rezeptverzeichnis
  • Stichwortverzeichnis
  • Literaturnachweis

Gross ist das Leid der Patienten mit Neurodermitis und nicht viel geringer derjenigen mit Schuppenflechte. Die Enttäuschung über die bloss Symptome unterdrückenden Therapien haben die Patienten hinter sich und haben erlebt, dass diese die Krankheit nur chronisch werden lassen. Beide Krankheiten können geheilt werden durch konsequentes Angehen der Ursachen: durch eine konsequente Entgiftung, durch eine nach allergologischer Austestung individuell auf den Patienten abgestimmte Heildiät aus vegetabiler Frischkost und neue Lebensordnung. Die Homöopathie allein kann diese Krankheiten nicht heilen, doch kann die auf den Patienten individuell und präzise zustimmende Arznei, in schrittweise aufsteigender Potenz, die epigenetische Erbkomponente der Neurodermitis und der Psoriasis allmählich löschen. Auch bei den anderen Hautkrankheiten ist die Ernährungs- und Lebensweise von grosser Bedeutung.

Nicht Symptomunterdrückung, sondern die Therapie der Ursachen ist für die Heilung der Hautkrankheiten entscheidend, sie ist ein Weg, der grosses Verständnis des Patienten und seines Arztes verlangt, ein gemeinsamer Weg, der sich lohnt.


Bircher-Benner Handbuch Nr. 24 für die Verhütung der Demenz und Alzheimerkrankheit

Diätanleitungen zur Verhütung und Therapie mit Rezepteil, eingehenden Ratschläge und ausgearbeiteter Kurplan aus einem ärztlichen Zentrum modernster Heilkunst.

Unsägliches Leid bringt die Demenz über uns Menschen. Vom Leben geprüft, nachdem wir viel geleistet, viel durchgestanden haben und uns auf einen ruhigen, wohlverdienten Lebensabend freuten, da ergreift sie uns erbarmungslos und nimmt uns den Verstand. Wir verstehen die Welt nicht mehr, nicht die Angehörigen nicht uns selbst. Ergriffen von Angst und Sinnestäuschungen verlieren wir jedes Vertrauen, das Vertrauen in uns selbst, das Vertrauen in all diejenigen, die einst uns achteten, die Geborgenheit und Heimat uns schenkten. Immer grösser wird die Not, bis nicht einmal mehr wir selbst uns pflegen, unser Alltägliches verrichten können, umgeben von Menschen deren Namen uns entfallen sind, die wir kaum mehr erkennen, nicht einmal unser eigenes Kind.
Als im Jahre 1906 der deutsche Psychiater und Neuropathaloge Alois Alzheimer erstmals“ einen seltenen Fall von Demenz, eine eigenartige Krankheit der Hirnrinde“ beschrieb, wurde dies kaum beachtet. Heute ist dieses Leiden eine gefürchtete Volkskrankheit.

Über die Ursachen ist man sich nicht einig. Nicht zu übersehen ist aber, dass diese stetige Zunahme der Alzheimerkrankheit auch der vaskulären Demenz und der Parkinsonkrankheit in allen Ländern westlicher Zivilisation vorhanden ist.

Bei allen häufigen Demenzformen, der Alzheimerkrankheit, der vaskulären Demenz, der LEWY-Körperchen-Demenz, welche im Rahmen der Parkinsonkrankheit auftritt und der selteneren Multisystematrophie (MSA), spielt die Vererbung kaum eine Rolle. Ohne die Parkinsonkrankheit und die Multisystematrophie mit einzubeziehen, leiden rund 2/3 der Demenzkranken an Alzheimer-und 1/3 an vaskulärer Demenz.

Den neurodegenerativen Krankheiten gemeinsam ist ein meist langsames Fortschreiten durch degenerative Entzündungsprozesse in unterschiedlichen Regionen des Nervensystems. In den letzten dreissig Jahren hat eine Vielzahl wissenschaftlicher Arbeiten immer mehr Teilursachen der Alzheimerkrankheit aufgezeigt. Die vaskuläre Demenz entsteht durch die Arteriosklerose, durch Gefässverschlüsse, Embolien und Blutungen ins Gehirn. Die Alzheimerkrankheit folgt im Wesentlichen denselben Risikofaktoren wie die Arteriosklerose. Es sind die Auswirkungen der allgemein verbreiteten unnatürlichen Lebens- und Ernährungsweise, wie Bewegungs- und Schlafmangel und in erster Linie einer artfremden, industriell verkünstelten Nahrung mit viel tierischen Produkten wie viel Fleisch, Ei und fettem Käse, Mangel an mehrfach ungesättigten Pflanzenölen und an den Vitaminen A, B, C,D,E und Folsäure und Mangel an antioxydativ und entzündungshemmenden sekundären Pflanzenstoffen aus frischer, roher, lebendiger Pflanzennahrung, bei hohem oxydativem Stress. Für die Alzheimerkrankheit und die LEWY-Body-Demenz der Parkinsonkranken sind die heute bedrohlich gewordenen Belastunge durch Umwelttoxine wie Schwermetalle, Pestizide, Reiz-,Suchtmittel und Medikamente zusätzlich von hoher ursächlicher Bedeutung.
Im Fokus medizinisch-wissenschaftlichen Denkens über die neurodegenerativen Krankheiten stehen vor allem Autoimmunprozesse, das heisst die zerstörenden Angriffe des Immunsystems auf körpereigene Strukturen des Nervensystems, auf Nervenzellen und die empfindlichen myelinhaltigen Nervenscheiden. So kann man verstehen, dass alle therapeutischen Anstrengung zur Bekämpfung z.B. der Multiplen Sklerose sich auf die medikamentöse Unterdrückung der krankhaften Autoimmunentzündung konzentriert. Bei der Alzheimerkrankheit stehen oxydative Vorgänge im Fokus, welche gewisse Eiweisse durch Phosporylierung unlöslich machen, so dass sie sich ins Zwischenzellgewebe und in die Nervenzellen einlagern und diese zerstören. Mit Milliardenbeträgen wird soweit erfolglos nach Medikamenten geforscht, welche diese degenerative Phosphorylierung verhindern sollen. Nur geringe finanzielle Mittel stehen dagegen zur Erforschung der eigentlichen Ursachen der Alzheimerkrankheit und einer Therapie der Ursachen zur Verfügung. Trotz des
Immensen finanziellen Aufwandes der medizinisch-pharmakologischen Forschung, schreitet die Krankheit stetig fort und breitet sie sich immer mehr aus.

Aber in jüngster Zeit beginnt die medizinische Wissenschaft auch die grossen geographisch-epidemiologischen Unterschiede in der Häufigkeit der Alzheimer- und der Parkinsonkrankheit ernst zu nehmen und zu verstehen. Man hat erkannt, dass diese Krankheit nicht durch Vererbung, sondern durch Unterschiede in der Ernährungs-und Lebensweise und Umweltbedingungen erklärbar sind. All diese Daten und eine Vielzahl neuer wissenschaftlicher Studien weisen auf eine grosse Bedeutung der in den westlichen Industrieländern allgemein verbreiteten Fehlernährung als Ursache hin. Die Ursachen, die Verhütung und Therapie der Multiplen Sklerose, der amyotrophischen Lateralsklerose, des Guillain-Barré-Syndroms und der Parkinsonkrankheit werden im Bircher-Benner Handbuch Nr.1 beschrieben.

Diesem Buch liegen alle modernen wissenschaftlichen Erkenntnisse zu Grunde, welche für das Verständnis, die Verhütung und eine wirksame ursächliche Therapie der Demenzkrankheiten wichtig sind. Hinzu kommen über hundert Jahre ärztlicher Erfahrung. Die vielen Patienten, die in dieser langen Zeit an der berühmten Bircher-Benner Klinik in Zürich und in unserem medizinischen Zentrum durch unsere vitale vegane Frischkost , neue Lebensordnung und sorgsame Elimination von toxischen Belastungen, Krankheitsherden und Störfeldern erfolgreich behandelt wurden, waren unsere grössten Lehrmeister. Dem kranken und seinen Angehörigen gibt dieses Buch alles nötige Wissen und die praktische Anleitung in die Hand, um die Demenzkrankheiten zu verhüten oder wenn sie schon entstanden sind, deren Verlauf positiv zu beeinflussen. Dem behandelnden Arzt ist dieses Buch eine bedeutende Hilfe bei der Anleitung und Führung seiner Patienten.

Inhalt:

  • Vorwort...7
  • Einleitung…9
  • Der Aufbau des zentralen Nervensystems..10
  • Das Grosshirn…10
  • Das Kleinhirn (Cerebellum)..10
  • Die Brücke…11
  • Die Basalganglien…11
  • Der Thalamuskern…11
  • Die Substantia nigra…12
  • Das limbische System…12
  • Die motorischen Bahnen…13
  • Die sensiblen Bahnen…13
  • Die hormonbildenden Drüsen des Gehirns…13
  • Der Hypophysenvorderlappen (Adenohypophyse)…13
  • Der Hypophysenhinterlappen (Neurohypophyse)…14
  • Die Zirbeldrüse (Epiphyse) und das Melatonin…14
  • Die Nervenzelle (Neuron)…14
  • Das Aktionspotential…15
  • Die Synapsen…16
  • Erregende Botenstoffe…16
  • Hemmende Botenstoffe…16
  • Die Bedeutung der Gliazellen im Gehirn…16
  • Die Hohlräume des Gehirns und die Flüssigkeit im Gehirn
  • und im Rückenmark…17
  • Die Blut-Hirnschranke…18
  • Die Myelin-Markscheiden, eine empfindliche Substanz…23
  • Demyelinisierende Erkrankungen…24
  • Remyelinisation…25
  • Krankheiten durch die Einlagerung von degenerativen Eiweissen…26
  • Die TAU-Proteine…26
  • Die Amyloidose…26
  • Die Wirkung der Ernährung auf das zentrale Nervensystem…28
  • Zweierlei Nahrungsenergie…28
  • Das Grundregulationssystem des zarten Bindegewebes im zentralen
  • Nervensystem…30
  • Oxydativer Stress im Zentrum der Ursachen der neurodegenerativen Krankheiten.32
  • Der Einfluss der Umweltbelastung durch Schadstoffe als Ursache für die neurogenerativen Krankheiten…34
  • Die neurotoxische Wirkung des Quecksilbers…34
  • Organische Zinnverbindungen und Neurodegeneration…35
  • Chlor und neurodegenerative Krankheiten…36
  • Die neurotoxische Wirkung flüchtiger organischer Kohlenwasserstoffe…37
  • Pestzide und neurodegenerative Krankheiten…39
  • Holzschutzmittel und neurodegenerative Krankheiten…39
  • Neurotoxische Medikamente und Neurodegeneration…39
  • Legale und verbotene Drogen und neurodegenerative Krankheiten…40
  • Cannabis…40
  • Amphetamine…40
  • LSD (Lysergsäure-Diethylamid)…40
  • Heroin, Morphium, andere Opiate…41
  • Kokain…41
  • Nikotin…41
  • Alkohol…41
  • Koffein…42
  • Zum Phänomen der Primär- und Sekundärwirkungen und der Gefahr
  • Medikamentöser Polypragmasie…43
  • Die Kombinationswirkung neurotoxischer Schadstoffe…44
  • Vitamine, Spurenelemente und neurodegenerative Krankheiten…45
  • Die Vielfältigkeit der Ursachen der neurodegenerativen Krankheiten…47
  • Der Formenkreis der neurodegenerativen Krankheiten…48
  • Systematik der neurodegenerativen Krankheiten…48
  • Die Demenz…50
  • Die Diagnose der Demenz…50
  • Demenzformen…50
  • Demenz wird immer häufiger..51
  • Offiziell anerkannte Risikofaktoren der Demenz..51
  • Die Symptomatik der Demenz…52
  • Die Diagnostik der Demenz…53
  • Hinweise zur Betreuung und Pflege demenzkranker Menschen…54
  • Die Alzheimerkrankheit…60
  • Ursachen der Alzheimerkrankheit…61
  • Das Geschehen im Gehirn bei der Alzheimerkrankheit…61
  • Die Symptomatik der Alzheimerkrankheit…61
  • Die Krankheitsstadien…63
  • Die Diagnose der Alzheimerkrankheit…63
  • Nicht jeder Gedächtnisverlust im Alter ist eine Alzheimerkrankheit…63
  • Das Früh- und Mittelstadium der Alzheimerkrankheit…63
  • Das fortgeschrittene Stadium der Alzheimerkrankheit…64
  • Die Wesensveränderung durch die Alzheimerkrankheit…64
  • Der körperliche Zerfall des Alzheimerkranken…64
  • Die Lebensprognose bei Alzheimerkrankheit…66
  • Prophylaxe und Therapie der Alzheimerkranken..64
  • Die offiziell anerkannten Risikofaktoren der Alzheimerkrankheit…66
  • Die Ordnungstherapie der Alzheimerkrankheit…66
  • Die diätetische Therapie der neurodegenerativen Krankheiten…66
  • Empfehlung für die Laborkontrollen für den behandelnden Arzt während
  • Der Diät…71
  • Die praktische Anwendung der Rohkost-Therapie…75
  • Speisezettel…75
  • Tagesmenü…77
  • Rezepte…79
  • Säfte…79
  • Birchermüesli…80
  • Früchte-Frischkorn-Speisen…82
  • Kaltschalen…82
  • Milcharten…83
  • Rohgemüse und Salate…83
  • Salatsaucen…84
  • Vorschläge für passende Saucen zu Salaten und Rohgemüse…87
  • Gekochte Speisen…88
  • Rezepte für gekochte Speisen…88
  • Gemüse…88
  • Salate von gekochten Gemüsen…91
  • Kartoffelgerichte…96
  • Getreidespeisen…97
  • Saucen…98
  • Belegte Brötchen…103
  • Desserts…104
  • Rezeptverzeichnis…109
  • Literaturnachweis…113
  • Stichwortverzeichnis…121

Produktinformationen zu „Bircher-Benner-Handbuch: Bd.24 Bircher-Benner Handbuch für die Verhütung der Demenz und Alzheimerkrankheit“.

Diesem Handbuch liegt das Wissen und die Jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute medizinisches Zentrum Bircher- Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohl- schmeckenden, erprobten, ab- wechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten .

Bircher-Benner Handbuch Nr. 26 Gesund und Schlank

Handbuch für Gewichtsprobleme, Adipositas und Anorexie

Diesem Buch liegt ein grosses Erfahrungsgut zu Grunde in der Behandlung von Patienten, die an Übergewicht, Adipositas oder Untergewicht, an Anorexia nervosa und Essstörungen leiden. Die Erhaltung der schlanken Körperform ist nicht nur eine Frage der Ästhetik. Sie ist in erster Linie eine Frage der Gesundheit. Ein Mensch in voller Gesundheit bewahrt bis ins hohe Alter seine ihm von der Natur gegebene harmonische Form, ohne abnormen Fettansatz, ohne schlaffes, gedunsenes Gewebe, ohne knotige Ablagerungen unter der Haut, landläufig als „Zellulitis“ bezeichnet und ohne Krampfadern. Die Muskeln bleiben elastisch, die Haltung aufrecht, der Gang fliessend, leicht und frei und die Haut bleibt warm und wohldurchblutet. Was äusserlich sichtbar wird, geschieht auch im Innern. Durch die allgemein verbreitete Fehlernährung ist der Stoffwechsel massiv überlastet. Degenerativ veränderte Eiweisse (Amyloide) oxydierte Lipide und andere degenerativ veränderte Substanzen, sowie Toxine welche anaerobe Bakterien einer pathologischen Darmflora bilden und die der Stoffwechsel nicht bewältigen und entgiften kann, lagern sich in die Zwischenzellsubstanz des zarten Bindegewebes ein, in die „Matrix“, die den ganzen Körper durchdringt und die durch die Lymphe gereinigt und drainiert wird. Die Matrix ist gleichzeitig unser Grundregulationssystem, das alle Organe, den ganzen Körper durchdringt. Sie ist der Ort, wo der Stoffaustausch zwischen den Zellen, den Blutkapillaren und den Nervenendigungen stattfindet.

Wird die Matrix durch die Schlacken eines überlasteten Stoffwechsels angefüllt, wird der Stoffaustausch und der Fluss biologischer Information allmählich und immer mehr beeinträchtigt. Die feinen Strukturen und Organe werden durch Übersäuerung und oxydativen Stress geschädigt, so dass degenerative Vorgänge und vorzeitige Alterung Überhand nehmen. Häufige hohe Blutzuckerspiegel durch eine Ernährung mit viel Zucker, Brot, Teigwaren, Gebäck aus Auszugsmehl, schädigen die innerste Auskleidung der Gefässe (Endothel). Diese feine Zellschicht reguliert den Bau und die Elastizität der ganzen Gefässwand1 . Durch ihre Schädigung durch häufige hohe Blutzuckerspiegel verlieren die Blutgefässe ihre Elastizität, es kommt zu Bluthochdruck und zu Krampfadern. Um die Kapillaren, welche in die Matrix der Arterienwände eingelagert sind, um diese zu durchbluten, lagern sich Schlackenstoffe ein und entzünden sich. Oxydiertes Cholesterin, Amyloide und Kalk lagert sich ein. In diese Weise beginnt oft schon in jungen Jahren die Arteriosklerose. Als Folge erleiden die Menschen Immer früher und häufiger die Katastrophe eines Herzinfarkts oder eines Hirnschlags. Stark oxydierende Stoffwechselschlacken (reactive oxygen species, R.O.S.) erzeugen in den Geweben gefährliche Spaltprodukte, so genannte „freie Radikale“. Diese sind so reaktiv, dass sie die Erbsubstanz (DNA) spalten können, so dass Genmutationen entstehen, die gesunde Zellen in Krebszellen umwandeln. Zudem schädigen sie Eiweisse, so dass diese unlöslich werden und sich als Amyloide niederschlagen. Geschieht dies in der Matrix des Gehirns, so entsteht die Alzheimerkrankheit. Greifen sie die fettlöslichen Strukturen der Nervenbahnen an (Myelin), so entsteht die multiple Sklerose oder es ein andere neurodegenerative Krankheiten. Greifen sie die Netzhaut und die Linse der Augen an, so entsteht der graue Star (Katarakt) und später im Leben die Erblindung durch die Makuladegeneration. Stoffwechselschlacken erzeugen die Zuckerkrankheit, die fettige Degeneration der Leber (Fettleber) und schädigen die Nieren. So bewirkt die Fehlernährung nicht nur Gewichtsprobleme, sondern eine allgemeine vorzeitiger Alterung. Leiden wir an Adipositas so verkürzt sich auf diese Weise die Lebenserwartung um durchschnittlich rund 20 Jahre.

2 . Reines Fasten und kalorienreduzierte Reduktionsdiäten können die oben beschriebene Stoffwechselschäden und die bereits entstandenen Gewebsschäden nicht beheben. Darum können die Patienten nach rein kalorisch gestalteter Reduktionsdiät zu 80 bis 90% das erreichte, tiefere Gewicht nicht halten.

3 . Ganz anders wirkt die in diesem Buch beschriebene Gewichtsreduktionsdiät mit vegetabiler Frischkost, Frischsäften, Pflanzenmilch und fester Rohkost. Sie bewirkt eine zuverlässige und nachhaltige Gewichtsreduktion über Monate bis hin zum Idealgewicht, da sie die Stoffwechselstörungen und die pathologischen Einlagerungen abbaut. Diese Diät ist bekömmlich. Obschon kalorisch reduziert, empfindet man keinen Hunger, da sie alle Substanzen, die wir benötigen in idealem Verhältnis enthält, so dass von nichts zu viel und von nichts zu wenig enthalten ist, mit Ausnahme des Vitamins B12, das ergänzt werden muss. Ihr hohes biologisches Energiepotential ist für die Patienten deutlich spürbar, wie auch der tiefgreifende Heilungsprozess, den sie in Gang setzt. Appetit und Körpergewicht werden durch ein äusserst komplexes hormonelles System reguliert, das auf Appetitzentren im Hypothalamus des Zwischenhirns einwirkt. Die Hormone werden teils durch die Zellen des Fettgewebes, teils im Verdauungstrakt, in den Inselzellen der Bauchspeicheldrüse und in der Muskulatur gebildet. Der Zustand des Milieus im Verdauungstrakt und dem Ökosystem der Bakterienflora beeinflussen bei dieser Diät die hormonelle Regulation rasch und damit das Appetitverhalten, den Energiehaushalt und das Körpergewicht nachhaltig. Ein krankes enterales Milieu ist dagegen nicht im Stande, die Appetit- und Gewichtsregulation zu gewährleisten. Je nach dem Grad des Übergewichts entsteht eine Resistenz gegen die Hormone, welche den Appetit und den Energieverbrauch regulieren, besonders gegen Leptin und Insulin. Diese wirken auf das Appetitzentrum im Hypothalamus des Gehirns. Bei Übergewicht entsteht eine Resistenz gegen diese Hormone, so dass der Appetit trotz übermässiger Nahrungszufuhr nicht mehr gebremst wird und kein Sättigungsgefühl mehr entsteht, bis endlich die Überfüllung des Magens Halt gebietet. Auch die Muskulatur erzeugt Hormone, welche das Körpergewicht regulieren. Diese bauen besonders das Fettgewebe der Bauchdecke und der inneren Organe ab. Bei Bewegungsmangel werden sie zu wenig gebildet. So entsteht die Stammfettsucht durch Einlagerung von Fettgewebe in die Eingeweide und die Bauchdecke. Mindestens eine Stunde täglichen Wanderns sind nötig, um dies zu verhindern.

Übergewichtige Menschen leiden sehr unter kränkenden Vorurteilen anderer. Oft werden sie in der Schule, im Beruf und im Privatleben in mancher Hinsicht benachteiligt und durch Ungerechtigkeiten gekränkt, so dass das Selbstwertgefühl und der Lebensmut leiden. Enorme seelische Schäden können dadurch entstehen, die nur durch eine konsequente, anhaltende Reduktion des Körpergewichts und viel Verständnis im therapeutischen Gespräch geheilt werden können. Noch ist das komplexe System der Regulation des Körpergewichtes wissenschaftlich nicht restlos aufgeklärt. Bei Menschen, die von ihrer Konstitution her zu mager sind, ohne krank zu sein, obschon sie reichlich Appetit haben und viel essen, ist die hormonelle Regulation des Appetitverhaltens in typischer Weise verändert und wieder ganz anders als bei der Anorexia nervosa. Menschen mit konstitutioneller Magersucht haben oft manche kalorienreiche Mastdiäten hinter sich, ohne Erfolg. Bei ihnen wirken die regulierenden Hormone paradox. Die Gründe sind wissenschaftlich nicht restlos geklärt. Bei Mastdiäten verlieren sie Gewicht, statt zuzunehmen. Unsere jahrzehntelange Erfahrung zeigt aber, dass Menschen mit konstitutioneller Magersucht gerade durch die vegetabile Frischkostdiät an Gewicht zunehmen, bis hin zum Idealgewicht. Dies weist darauf hin, dass die vegetabile Frischkostdiät sowohl bei Übergewicht, als auch bei Anorexie die gestörte hormonelle Regulation für das Appetitverhalten und das Körpergewicht positiv beeinflusst. Auch bei Essstörungen, wie Heisshungerattacken (Bing eating), Anorexia nervosa und Bulimie ist dies der Fall. Heisshungeranfälle sind die Folge einer, bezogen auf das biologische System, falsch zusammengesetzten Ernährung mit rasch verdaulichen Kohlenhydraten. Jeder rasch und hoch ansteigende Blutzuckerspiegel wird nach jeder Essattacke mit einer sehr hohen Insulinausschüttung beantwortet, die zur Unterzuckerung führt und damit zur nächsten Heisshungerattacke. Die vegetabile Vollwertkost mit hohem Anteil an vegetabiler Frischkost (Rohkost), lässt das Insulin nur langsam ansteigen. Darum behebt sie Heisshungeranfälle und Essattacken zuverlässig. Menschen, die an Anorexia nervosa leiden, nehmen diese Art der Vollwertkost gerne an und sind dankbar, da sich ihr quälendes Völlegefühl und die Bulimieattacken rasch bessern. Da die seelischen Ursachen sehr tief liegen, kann die Heilung aber nur gelingen, wenn, gleichzeitig mit der Diät, in therapeutischer Arbeit, die meist in der ganz frühen Kindheit wurzelnden seelischen Traumen, angegangen werden, so dass sie ins Bewusstsein gelangen und die Patientinnen in der Lage sind, das Essverhalten zu korrigieren. Die hormonelle Regulation ist bei der Anorexia nervosa massiv gestört und zwar in ganz besonderer Weise. Bekanntlich können akute Krisen sehr gefährlich sein, so dass sie oft nur in einem therapeutischen Klinikaufenthalt bewältigt werden können, wo die intensive seelische Betreuung, die Diät und die Lebensordnungen gleichzeitig angegangen werden. Leider ist aber das Wissen um die Bedeutung des diätetischen Teils der Therapie dieser Krankheit in den meisten spezialisierten Kliniken noch nicht genügend vorhanden. Auch für ältere Menschen kann ein starker Gewichtsverlust, eine Anorexie, bedrohlich sein. Auch bei ihnen zeigt die hormonelle Störung ein typisches Muster, jedoch wieder ganz anders als bei der Anorexia nervosa oder einedurch eine chronische Krankheit, wie zum Beispiel Krebs bedingt, in der Regel durch degenerative Veränderungen im Milieu des Verdauungstraktes da die Vollwertigkeit der Ernährung vernachlässigt wurde. Auszehrende Krankheiten wie chronische Infektionen und Krebs führen zu enormer Schwäche und einem grossen Gewichtsverlust (Kachexie), der durch Mastdiäten nicht zu beheben ist. Gerade auch in solchen Situationen ist die vegetabile Vollwertkost mit hohem Anteil an vegetabiler Frischkost (Rohkost) von grosser Hilfe. Dieses Buch dient einer umfassenden Therapie, die sich nicht gegen Symptome, sondern gegen die Krankheitsursachen richtet. Es vermittelt sowohl die bis heute bekannten wissenschaftlichen Grundlagen über die Probleme der Regulation von Appetit, Energiehaushalt und Körr konstitutionellen Magerkeit. Ein starker Gewichtsverlust im Alter entsteht, wenn nicht durch eine chronische Krankheit, wie zum Beispiel Krebs bedingt, in der Regel durch degenerative Veränderungen im Milieu des Verdauungstraktes da die Vollwertigkeit der Ernährung vernachlässigt wurde. Auszehrende Krankheiten wie chronische Infektionen und Krebs führen zu enormer Schwäche und einem grossen Gewichtsverlust (Kachexie), der durch Mastdiäten nicht zu beheben ist. Gerade auch in solchen Situationen ist die vegetabile Vollwertkost mit hohem Anteil an vegetabiler Frischkost (Rohkost) von grosser Hilfe. Dieses Buch dient einer umfassenden Therapie, die sich nicht gegen Symptome, sondern gegen die Krankheitsursachen richtet. Es vermittelt sowohl die bis heute bekannten wissenschaftlichen Grundlagen über die Probleme der Regulation von Appetit, Energiehaushalt und Körpergewicht und die Krankheiten, die daraus folgen. Es enthält die praktische Anleitung zur diätetischen Therapie von Anorexie und Übergewicht. Die Patienten, die während über 100 Jahren an der berühmten Bircher-Benner Klinik in Zürich, heute medizinisches Zentrum in Braunwald, durch unsere vegetabile Frischkostdiät, durch neue Lebensordnung und unsere sorgsame seelische Betreuung geheilt worden sind, waren unsere grössten Lehrmeister. Dem Kranken und seinen Angehörigen gibt dieses Buch alles nötige Wissen und praktische Anleitung in die Hand, um diese Probleme des Körpergewichts und Essverhaltens erfolgreich und dauerhaft zu heilen. Dem behandelnden Arzt ist dieses Buch eine bedeutende Hilfe bei der Anleitung und Führung seiner Patienten.

Inhalt

Vorwort  . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9
Das Körpergewicht . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .13
Die Beurteilung des Körpergewichts . . . . . . . . . . . . . . . . . . . . . . . . .13
Tabellen zum Idealgewicht . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .14
Das Idealgewicht erwachsener Männer . . . . . . . . . . . . . . . . . . . . . . . .14
Das Idealgewicht erwachsener Frauen . . . . . . . . . . . . . . . . . . . . . . . .15
Das Gewicht, das bei der Diätbehandlung anzustreben ist (Sollgewicht) . . . . . . .17
Gewichtstabelle für Kinder . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17
Gewichtstabelle für Männer . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .19
Gewichtstabelle für Frauen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 21
Die Bedeutung des Körpergewichts für die Gesundheit und die
Lebenserwartung, verschiedene Formen des Übergewichts . . . . . . . . . . . . . 23
Der Bauchumfang an der Taille . . . . . . . . . . . . . . . . . . . . . . . . . . . .23
Die neurobiologische Steuerung von Appetit, Energieverbrauch,
Hormonspiegel und Wachstum . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 24
Die Sättigung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .24
Hormone, welche die Sättigung und den Energiehaushalt regulieren . . . . . . .25
Die Veränderung des Geschmackssinns bei Adipositas und Anorexia nervosa . . . .28
Die Notregulation des Essverhaltens . . . . . . . . . . . . . . . . . . . . . . . . . . .29
Die Komplexität der Regulation von Appetit,
Körpergewicht und Energieverbrauch . . . . . . . . . . . . . . . . . . . . . . . . . 30
Die Bedeutung des Milieus im Darm und der Darmflora . . . . . . . . . . . . . . . .31
Die Darmflora bei Untergewicht und Anorexia . . . . . . . . . . . . . . . . . . . . .34
Die Darm-Hirnachse . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .37
Übergewicht und Adipositas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .39
Die Ursachen der Adipositas . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40
Genetische Faktoren . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .40
Vorgeburtliche Faktoren . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .40
Die epigenetische Prägung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .40
Prävention beginnt bereits im Mutterleib . . . . . . . . . . . . . . . . . . . . . . . 42
Der Einfluss der frühkindlichen Ernährung . . . . . . . . . . . . . . . . . . . . . . .43
Fehlernährung und Bewegungsmangel . . . . . . . . . . . . . . . . . . . . . . . . . .44
Die Mitochondrien, die Kraftwerke der Zellen . . . . . . . . . . . . . . . . . . . . 46
Der Einfluss der Nahrung auf den Blutzuckerspiegel und die Gesundheit . . . . . .47
Glykämischer Index und glykämische Ladung . . . . . . . . . . . . . . . . . . . .47
Der glykämische Index (glycemic index GI) . . . . . . . . . . . . . . . . . . . . .47
Die Glykämische Ladung (glycemic load, GL) . . . . . . . . . . . . . . . . . . 47
Oxydativer Stress im Zentrum der Ursachen degenerativer Krankheiten . . . . . .49
Die Nahrungsenergie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .52
Das Problem der Nahrungsenergie . . . . . . . . . . . . . . . . . . . . . . . . . .52
Zweierlei Nahrungsenergie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53
Das Grundregulationssystem des zarten Bindegewebes (Matrix) . . . . . . . . . . .55
Die Bedeutung der Nahrungsökonomie . . . . . . . . . . . . . . . . . . . . . . .55
Das Integralgesetz der Nahrung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .58
Die Lebendigkeit der Nahrung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59
Sekundäre Pflanzenstoffe (Phytochemicals) . . . . . . . . . . . . . . . . . . . . . . .60
Die Bedeutung der Bewegung . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .62
Die Bedeutung des Schlafs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .63
Die Bedeutung des Seelenlebens bei Übergewicht und Essstörungen . . . . . . . . .64
Schwangerschaft und Körpergewicht . . . . . . . . . . . . . . . . . . . . . . . . . . .65
Die Folgekrankheiten der Adipositas . . . . . . . . . . . . . . . . . . . . . . . . . . .66
Metabolisches Syndrom, Adipositas, Hypertonie, Diabetes mellitus . . . . . . . .66
Von der Adipositas zum Diabetes mellitus . . . . . . . . . . . . . . . . . . . . 66
Von der Adipositas zu Bluthochdruck und zu den
Herz-Kreislaufkrankheiten . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .67
Die Stoffwechselwirkung der Bewegung und des Ruhens . . . . . . . . . . . . 67
Allgemeine Richtlinien zur Ordnungstherapie der Adipositas . . . . . . . . . . . 69
Die Grundpfeiler der Therapie sind . . . . . . . . . . . . . . . . . . . . . . . . . .69
Zur Diät . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .69
Fastenreaktionen und deren Behandlung . . . . . . . . . . . . . . . . . . . . . . . . .71
Der Gewichtsverlauf . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .72
Typische Gewichtskurven . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73
Verlauf des durchschnittlichen Körpergewichtes bei abwechselnder
Saft-Rohkost und Vollkost-Diät nach Bircher . . . . . . . . . . . . . . . . . . . .73
Das Cholesterin . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .74
Einfluss der Bircher’schen Diättherapie bei Adipösen auf das
Serumcholesterin . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .74
Einfluss der Bircher’schen Diättherapie bei Adipösen auf den Blutdruck . . . 75
Der Blutdruck . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 75
Essstörungen, Bing-Eating und Anorexia nervosa . . . . . . . . . . . . . . . . . . . .77
Die diagnostischen Kriterien der Anorexia nervosa . . . . . . . . . . . . . . . . .78
Die Therapie der Essstörungen und der Anorexia nervosa . . . . . . . . . . . . . . .83
Das ärztliche Gespräch . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .83
Der diätetische Ansatz der Therapie der Essstörungen und der
Anorexia nervosa . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .84
Die Familientherapie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .85
Die kognitive Verhaltenstherapie . . . . . . . . . . . . . . . . . . . . . . . . . . .85
Die Gruppentherapie gemeinsam mit den Eltern . . . . . . . . . . . . . . . . . .85
Die stationäre Therapie der Anorexia nervosa . . . . . . . . . . . . . . . . . . 85
Die Ernährungstherapie bei Bulimia nervosa . . . . . . . . . . . . . . . . . . . .87
Die psychoedukative Führung der Bulimie Patientin . . . . . . . . . . . . . . . .87
Der Therapievertrag . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88
Die Einzeltherapie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .88
Die konstitutionelle Magerkeit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90
Kachexie, die Abmagerung durch schwere Krankheiten oder Hunger . . . . . . . 91
Zur Diät bei Untergewicht, Anorexia nervosa und Kachexie . . . . . . . . . . . . . 93
Die Infusionstherapie . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .95
Die Durchführung der Diät . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 96
Die Kurpläne zur Gewichtsreduktion . . . . . . . . . . . . . . . . . . . . . . . 96
Allgemeine Regeln für die erste Woche . . . . . . . . . . . . . . . . . . . . . . 98
Allgemeine Ratschläge für ein Jahr nach Abschluss der Kur . . . . . . . . . . . .99
Grundformen der Diät bei Übergewichtigkeit und Fettsucht . . . . . . . . . . . . .100
Verschiedene Diätstufen und ihre Anwendung in der Schlankheitskur . . . . . .100
Die Durchführung der Diät bei Untergewicht . . . . . . . . . . . . . . . . . . . . . .102
Die Diät bei Anorexia nervosa . . . . . . . . . . . . . . . . . . . . . . . . . . . 102
Die Diät bei konstitutionellem Untergewicht . . . . . . . . . . . . . . . . . . . .104
Die Diät in hohem Alter und bei krankheitsbedingter Kachexie . . . . . . . . 104
Wasseranwendungen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .105
Fichtennadelbad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105
Dauerlichtbad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .105
Lichtschwitzbad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .105
Heublumensitzbad oder Heublumenschenkelbad . . . . . . . . . . . . . . . . . .105
Kuhne’sches Reibesitzbad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .105
Armbad (nach Hauffe) . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105
Wechselfussbad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .106
Wassertreten . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 106
Wechselwarme Abwaschung . . . . . . . . . . . . . . . . . . . . . . . . . . . . 106
Wechseldusche . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 106
Trockenbürsten . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .106
Sonnenbad . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 106
Nahrungswerte von Gemüse und Obst nach Nährgehalt . . . . . . . . . . . . . . . .107
Gemüse . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107
Obst . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107
Speisezettel . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108
Prinzipien der Auswahl bei der Diätzusammenstellung . . . . . . . . . . . . . . .108
Eine Woche für jeden Monat des Jahres . . . . . . . . . . . . . . . . . . . . . . .108
Ein Woche Diät zur Erhaltung der schlanken Linie . . . . . . . . . . . . . . . . .109
Januar bis März . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .109
April bis Juni . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110
Juli bis September . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110
Oktober bis Dezember . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .111
Eine Woche strenge Diät zur Erhaltung der schlanken Linie . . . . . . . . . . 111
Diät-Rezepte für die gesunde, schlanke Linie . . . . . . . . . . . . . . . . . . . . . .114
Vorbereitende Erklärungen zur Frischsaftdiät . . . . . . . . . . . . . . . . . . 114
SÄFTE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 114
Die Frischsäfte . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 114
Schleim als Zusatz zu Säften . . . . . . . . . . . . . . . . . . . . . . . . . . . . 115
Gemüsesäfte . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 116
Besonders bekömmliche Saftrezepte für gemischte Säfte . . . . . . . . . . . . 116
BIRCHER-MUESLI . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 117
ROHGEMÜSE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 118
SALATSAUCEN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 120
MILCHARTEN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 122
BUTTER, REFORM-PLANZENFETTE UND ÖLE . . . . . . . . . . . . . . .123
SUPPEN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 124
DIE GEKOCHTEN GEMÜSE . . . . . . . . . . . . . . . . . . . . . . . . . . 126
SALATE VON GEKOCHTEN GEMUSEN . . . . . . . . . . . . . . . . . . . .132
BELEGTE BROTE (dünne Vollkornbrotschnitten) . . . . . . . . . . . . . . . .133
KARTOFFELGERICHTE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .133
GETREIDESPEISEN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .134
SAUCEN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 136
SÜSS-SPEISEN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 136
GESUNDHEITS-TEES . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 139
GETRÄNKE . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .140
Gymnastische Übungen zur Erhaltung der schlanken Linie . . . . . . . . . . . . . 141
Training für die Wirbelsäule und Rumpfmuskulatur . . . . . . . . . . . . . . . 141
Training für Bauch- und Rückenmuskulatur . . . . . . . . . . . . . . . . . . . . .141
Training für Schultergürtel und Brustkorb . . . . . . . . . . . . . . . . . . . . . .143
Training aus dem Schultergürtelstand . . . . . . . . . . . . . . . . . . . . . . . 144
Training für die Elastizität der Gelenke . . . . . . . . . . . . . . . . . . . . . . 144
Anhang und Tabellen Diät bei Gewichtsproblemen . . . . . . . . . . . . . . . . . 146
Berechnete Tagesmenüs für die Diät (1200 –2100 K) . . . . . . . . . . . . . . . .146
Tabelle zum Glykämischen Index und der glykämischen Ladung . . . . . . . . . . .156
Verzeichnis der Rezepte und Kurpläne . . . . . . . . . . . . . . . . . . . . . . . . . .160
Literaturnachweis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 164
Stichwortverzeichnis . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 167

Handbuch für Gewichtsprobleme, Adipositas und Anorexie: 
Diesem Handbuch liegt das Wissen und die jahrzehntelange Erfahrung aus einem ärztlichen Zentrum modernster Heilkunst, der weltberühmten Bircher-Benner-Klinik, heute Medizinisches Zentrum Bircher-Benner, zu Grunde. Dem Kranken ist dieses Buch eine grosse Hilfe für seine aktive Mitarbeit auf seinem Weg zur Heilung und Vorbeugung der Krankheit. Es ermöglicht ihm den Einblick in die wissenschaftlichen Grundlagen und Ursachen seiner Krankheit und gibt ihm wertvolle Anleitungen für die Diätetik, die Pflege und physikalischen Anwendungen in die Hand. Das Buch erklärt die Diätetik in aufbauenden Stufen, bereit zur einfachen praktischen Anwendung und ist mit wohlschmeckenden, erprobten, abwechslungsreichen Diätrezepten aus der Bircher-Benner-Klinik ausgestattet. Für den Arzt ist dieses Buch eine grosse Zeitersparnis und eine wertvolle Hilfe bei der Führung seiner Patienten.


Ordnungsgesetze des Lebens

Dr. med. Max Bircher-Benner

In ungeahntem Mass ist die Entwicklung der Medizin heute an ihre Grenzen gestossen. Der Gesundheitszustand der Menschen hat sich trotz eines kaum mehr tragbaren Aufwandes im Gesundheitswesen zwar verändert, aber nicht wirklich gebessert. Unsere moderne Medizin war fähig, lebensbedrohliche Situationen aufzufangen. Sie war fähig, grosse epidemische Krankheiten einzudämmen. Aber an ihre Stelle sind andere chronische Leiden getreten. Früher denn je erkranken unsere Patienten an degenerativen und chronischen Leiden, denen wir Ärzte trotz unseres grossen Arsenals an Medikamenten mehr oder weniger machtlos gegenüber stehen.

Es gelingt uns, deren Symptome teilweise zu lindern, Komplikationen zu verzögern, aber nicht wirklich, sie zu verhüten oder gar zu heilen.
Im Bericht der Weltgesundheitsorganisation WHO vom 5. Mai 1997 hiess es bereits: „ Die chronischen Krankheiten haben weltweit zugenommen und die infektiösen Krankheiten breiten sich weltweit aus: Hunderte von Millionen Menschen werden in den kommenden Jahren Opfer von Krebs, Herz- und Kreislaufkrankheiten sein, sowie von Erkrankungen der Atemwege. “ Allein in den EU-Ländern berechnet man damals für die folgenden 25 Jahre eine Zunahme des Brustkrebses um 30% und des Prostatakrebses um 40%. Ähnlich sah man die Prognose für die Herz-Kreislaufkrankheiten, die Adipositas, den Diabetes und für andere degenerative Krankheiten, etwa des rheumatischen Formenkreises, der Leberzirrhose, den Autoimmunkrankheiten, der Neurodermitis und den Allergien.

11 Jahre später, in den WHO-Statistiken von 2008 sieht es nicht anders aus: „ 80% der vorzeitigen Todesfälle gehen zu Lasten chronischer Krankheiten( inklusive Herzkreislaufkrankheiten, Hirnschlag und Krebs) Die statischen Prognosen zeigen, dass die Anzahl Todesfällen an chronischen Krankheiten in ständiger die Zunahme begriffen sind und zwar für Männer und Frauen in gleicher Weise…2015 sollen auch in den Entwicklungsländern die nicht übertragbaren chronischen Krankheiten (NCDs) die führende Todesursache sein.“
Bei aller Bewunderung für die Meisterschaft und das Genie der medizinischen Technik und Pharmakologie, können wir Ärzte nicht mehr übersehen, dass unsere moderne Medizin in ihrer Aufgabe, die häufigsten Krankheiten unserer Patienten zu verhüten und sie heilen, versagt hat.

In unangenehmer Weise führt uns das multiple Leiden unserer Patienten ins Spital und ambulanter Sprechstunde den Mangel unserer Methode vor Augen. Wir kommen nicht mehr lange darum herum, unser wissenschaftliches Paradigma, die Richtigkeit unseres sorgsam gelernten Verständnisses der Biologie des Menschen und seiner Krankheiten, mindestens teilweise, in Frage zu stellen.
Die massive Zunahme der chronischen Krankheiten unserer Zivilisation trotz immer grösseren, kaum mehr tragbaren Aufwandes zeigt, dass ein grundlegendes Missverständnis zwischen unserer medizinischen Wissenschaft und der biologischen Natur des Menschen bestehen muss.

Noch weitgehend ist das wissenschaftliche Paradigma unserer Zeit von Maschinenmodell René Descartes geprägt. Wohl hat die rein materielle Betrachtung und Zerlegung des Menschen in einzelne, den Organen zugeordnete Funtionsbereiche und Fachgebiete ihre Berechtigung. Doch verführt sie uns machmal zu fragmentarischem Denken, mit der Gefahr, die Auswirkungen einer spezialärztlichen Massnahme auf andere Organbereiche und auf das biologische System des Menschen, das auf jeden Reiz als Ganzes reagiert, zu übersehen.
Mit energetischen Betrachtungen hatte Descartes gründlich aufgeräumt. Die Existenz einer Seele wurde nach ihm ernsthaft in Frage gestellt. Psychische Zustände waren Nervenkrankheiten, seelische Zusammenbrüche „ Nervenzusammenbrüche“. Sie wurden dem Nervenarzt zugewiesen. Erst zweihundert Jahre später gab es dann den Seelenarzt, den Psychiater und erst dreihundert Jahre später die Psychosomatik. Noch leidet unser ärztliches Denken manchmal unter dieser künstlichen Trennung. Finden wir Ärzte über oft längere Zeit nichts somatisches, so sprechen wir von „supranasal“ und weisen den Patienten dem Psychiater zu.

Inzwischen haben die Molekularbiologie und die Biophysik bei der Erforschung energetischer Phänomene im biologischen System grosse Erkenntnisse erzielt, welche unserem klinisch- wissenschaftlichen Paradigma zum Teil diametral entgegenstehen: Der Nachweis der intrazellulären Lichtspeicherung und der intrazellulären Phtonenamplifikation nach dem Laserprinzip und die Molekularbiologische Erforschung des Extrazellularraumes, der Grundsubstanz des zarten Bindegewebes, mit ihrer dichten Netzstruktur aus Proteoglykanen und Glucosaminen als Molekuarsieb und als Leitungssystem komplexer informationen im biologischen System, welche die Funktionsweise der biochemischen Abläufe steuert sind wissenschaftlich anerkannten.
Die Erkenntnisse des Nobelpreisträgers Ilya Prigogine über den Umschlag biochemischer Systeme aus dem Chaosprinzip in ein ordnendes Kohärenz unter dem Einfluss hochgeordneter Energie (Lichtenergie) sind mit dem derzeitigen medizinischen Paradigma nur teilweise vereinbar. So ist es nicht erstaunlich, dass sie von den medizinisch forschenden Ärzten kaum beachtet worden sind.
Der Einbezug energetischer Kenntnisse wird das Paradigma unserer medizinischen Wissenschaft verändern. Kalorien als Mass chaotischer Verbrennungsenergie werden als Mass für die Nahrungsenergie ausgedient haben. Der zweite Hauptsatz der Energetik, das Entropiegesetz wird in der Ernährungslehre und Diätetik Einzug erhalten. Nahrungsmittel werden neu nach ihrem Gehalt an hochgeordneter Energie, nach ihrer Nähe zur Photosynthese beurteilt werden, nach ihrem Gehalt an biologisch ordnender Information.
Der Eigentliche Gegensatz zwischen unserer universitären medizinischen Wissenschaft und derjenigen einer wissenschaftlich forschenden Naturheilkunde und Komplementärmedizin liegt in der Frage der Energie.

Die heilende Wirkung vitaler pflanzliche Frischkost (Rohkost) ist klinisch vielfach belegt.
Ohne grundlegendes Verständnis der immateriellen Informationsübermittlung im biologischen System kann es nicht gelingen, die immaterielle, rein informative Wirkung homöopathischer Arzneien zu verstehen. Man wird damit fortfahren, die Homöopathie als blosse Placebowirkung oder Scharlatanerie lächerlich zu machen. Die energetische Grundregulation in der Grundsubstanz des mesenchymalen Bindegewebes und deren direkte Auswirkung auf das Neurovegetativum und die hormonale und interzelluläre Regulation bildet die wissenschaftliche Grundlage der regulativen Naturheilkunde und Komplementärmedizin.

Die Ausbereitung der regulativen Wirkung erfolgt kybernetisch. Damit können die meist einfachen, linearen Denkansätze der aktuellen medizinisch- wissenschaftlichen Forschungsmethodik nicht mithalten. Es brauche neue Ideen, neue Modelle, ein grundlegend neues wissenschaftliches Verständnis, neue Ansätze und Definitionen für unsere „ Evidence based Medicine“. Dies ist die Bedeutung der Naturheilkunde und Komplementärmedizin für das neue Paradigma, die neue medizinische Schule.
Schon am Anfang des 20. Jahrhunderts hat Maximilian Bircher-Benner als wissenschaftlich scharfsinnig denkender und forschender Arzt mit einem Erfahrungshintergrund aus der erfolgreichen Therapie viel tausend Menschen diese Grenze des damaligen und heue noch immer unveränderten wissenschaftlichen Paradigmas erkannt und ganz neue Wege aufgezeigt. Damals wurden seine Erkenntnisse weltweit sehr beachtet. Doch haben der zweite Weltkrieg und die Entdeckung der Cortisontherapie und der Antiobiotika die medizinischen Schulen in anndere Richtungen geleitet, denn vorerst glaubte man, damit alle Krankheiten heilen zu können.

Das Buch“ Ordnungsgesetze des Lebens“, das aus seinen drei grossen Londoner Vorträgen von 1938 entstanden ist, enthält faszinierende Erkenntnisse diese grossen Pioniers, die heute aktueller sind denn je und zeigt unserer modernen medizinischen Wissenschaft und allen suchenden Menschen einen Weg aus ihrer Sackgasse, einen Weg zu einem ganz neuen wissenschaftlichen Denken und Verständnis der Biologie des Menschen, der Krankheitsursachen und ganz neue Wege der Therapie.

Braunwald, im November 2013
Dr. med. Andres Bircher

Vorwort
Vorwort des Verfassers
1. Vortrag:
Sie wusste nicht, warum sie krank wurden
1. Das Organisationsgesetz der Nahrung
2. Das Gleichgewichtsgesetz der Ernährung
3. Das Ökonomiegesetz
4. Das Mundgesetz
5. Das Ordnungsgesetz des Hautorgans
6. Das Ordnungsgesetz der Lungen
7. Das Ordnungsgesetz der Beziehung zur Schwerkraft
8. Das Ordnungsgesetz des Lebensrhythmus
9. Das Ordnungsgesetz des Seelenlebens


2. Vortrag:
Die Hölle der Ungesundheit
Unordnungskrankheiten:
1. Die Rachitis oder englische Krankheit
2. Die Möller-Barlowsche Krankheit Säuglinge
3. Die Herter-Heubnersche Krankheit oder Coeliakie
4. Die Darmträgheit, Konstipation, Darmfäulnis, intestinale Toxaemie, Colitis, Colibazillose
5. Die Eingeweidesenkung oder Glendardsche Krankheit
6. Die Zahnkaries und ihre Folgen. Die Oralsepsis
7. Die Zahnbetterkrankung, Zahnlockerung, Zahntascheneiterung
8. Schädigungen und Krankheiten der Blutkreislauforgane
9. Blutkrankheiten
10.Infektionskrankheiten
11. Krankheiten infolge gestörter Harmonie und Erkrankung der Einsonderungsdrüsen
12. Stoffwechselkrankheiten
13. Hautkrankheiten
14. Allergische Krankheiten
15. Steinleiden
16. Schwangerschaftsstörungen, Frauenleiden und Fortpflanzungsstörungen,
17. Angeborener Schwachsinn, Wachstumshemmungen und Missbildungen
18. Erkrankung der Sinnesorgane
19. Die rheumatischen Krankheiten
20. Geisteskrankheit
21. Seelenkrankheiten, Psychoneurosen
22. Substanzkrankheiten des Nervensystems
23. Die Krebskrankheit

3. Vortrag:
Die Rückkehr ins Reich der Ordnungen
Das Gesunden
Schlussfolgerungen
Die Richtlinien der Ordnungstherapie:
1. Heilernährung
2. Ordnung der Beziehungen zur unbelebten Umwelt
3. Ordnung des Seelenlebens
Nachtrag
Nachwort

Den Inhalt dieser drei Vorträge widme ich den Kranken und Leidenden, welche wissen wollen, woher ihre Not kam und noch Entschlossenheit und Selbstüberwindungskraft genug besitzen, um den hier gezeigten Rückweg zur Gesundheit zu gehen. Ich widme ihn auch meinen verehrten Kollegen und allen denkenden und klugen Menschen, welche hören wollen, wie das Elend der Ungesundheit verhütet werden kann.

Daß von Tausenden von kranken Menschen, deren Not ich kennen lernte, nicht einer, selbst nach langer Vorbehandlung, wußte, warum er krank geworden war und weshalb seine Krankheit nicht weichen wollte, zeigt den erstaunlichen Mangel an Lebens- und Gesundheitskunde der Menschen unserer Zeit bis hinauf in die gebildeten und gelehrten Stände. Ich kann Nietzsche nicht widersprechen, wenn er sagt:
»Nein, die Stunde dafür ist noch nicht gekommen. Noch fehlen vor allem die Ärzte, für welche das, was wir bisher praktische Moral nannten, sich in ein Stück ihrer Heilkunst und Heilwissenschaft umgewandelt haben muß; noch fehlt allgemein jenes hungrige Interesse an diesen Dingen, das vielleicht einmal dem Sturm und Drang jener alten religiösen Erregungen nicht unähnlich erscheinen wird; noch sind die Kirchen nicht im Besitz der Pfleger der Gesundheit; noch gehört die Lehre von dem Leibe und von der Diät nicht zu den Verpflichtungen aller niederen und höheren Schulen;. . .«
Mit diesen drei Vorträgen wird die frohe Botschaft verkündet, daß die Stunde, die Nietzsche sah, nun kommt. Doch müssen ihr alle, die Gesunden, die Kranken und die Ärzte, den Weg bereiten: die ersteren dadurch, daß sie ihre Aufmerksamkeit und ihr Denken der Lehre vom Leibe und von der Diät, von der Herkunft der Ungesundheit und der Rückkehr ins Reich der Ordnungen, dem Preis, der für die Wiedergesundung bezahlt werden muß, zu¬wenden; die letzten dadurch, daß sie sich mit Herz und Hand der Reformation der Heilkunde, sowohl hinsichtlich Diagnose und Therapie, als auch im ärztlichen Denken, hingeben. Ohne ernste Bemühung und Arbeit wandelt sich nichts.

Körperliche und seelische Leiden haben einen Sinn; ihn erkennen und erfüllen - das ist der Weg.

Den zweiten Vortrag habe ich bei der Niederschrift für die Drucklegung wesentlich erweitert.
Die Übersetzung in die englische Sprache besorgten die beiden Damen Fräulein D. Hecht und Fräulein Dr. med. E. F. Meyer in London, denen ich hier meinen wärmsten Dank ausspreche. Mit höchster Anerkennung und Dankbarkeit möchte ich hier auch der vielen Dienste gedenken, welche mir durch den ehrenamtlichen Sekretär der Food Education Society, Herrn Charles E. Hecht, zuteil geworden sind. Unvergeßlich bleiben mir meine drei Präsidenten: Sir Robert McCarrison, Captain Elliston, M. P. und Herausgeber des Medical Officer, und Dame Louise Mclllroy, M. D., sowie die Sprecher aus Ärzte- und Krankenpflegekreisen am Schlüsse des dritten Vortragsabends. Eine schöne Überraschung aber bedeutete mir die Stunde im Royal Free Hospital, da mir der Rheumafilm mit den nur mit meiner Heildiät behandelten Patienten durch Dr. Pillman Williams vorgeführt wurde.

Dr. med. Maximillian Oskar Bircher-Benner


Bircher-Benner Leben und Lebenswerk

Wegbereiter der neuen Ernährungslehre und Heilkunde.

Zum Geleit:
„ Das Wirken dieses grössten Arztes gleicht einer lodernden Flamme, die das Feuer der Erkenntnis in vielen Menschen entzündete und die über unsere Generation hinweg auf die nachfolgenden Geschlechter wirken wird.“

So schrieb Prof. Dr. med. W. Heupke in der Münchner Medizinischen Wochenschrift zum Hinschied Dr. M. Bircher-Benners. Worin bestanden die „Grösse“, das „ Feuer“ und die „ Wirkung“ dieses Mannes? Wenige wissen darüber Bescheid, selbst unter seinen Freunden und Anhängern. Darum habe ich mich in diesem Buche bemüht, eine Vorstellung von diesem Leben und Lebenswerk, von seiner Beweggründen und Zielen, Selbstüberwindungen und Erfüllungen zu geben, indem ich das Wesentliche so objektiv und einleuchtend herauszuarbeiten suchte, als das einem Sohne möglich ist. Jene, die ihn als“ Vater einer neuen Ernährungslehre“ oder als Pionier eines neuen Arzttums“-oder wie die öffentlichen Kennzeichnungen lauten mögen- kennen, finden hier erstmals alles in Kürze von der heutigen Kenntnis aus betrachtet, zusammengestellt. Für die Öffentlichkeit aber , die nicht viel mehr als den Namen kennt, und besonders für die Jungen, suchte ich das Eigentliche und wie ich glaube, Wertvollste an diesem Leben herauszuarbeiten: wie man die Furche vor den Menschen verliert! Mancher hat Wertvolles in sich und kann es nicht aus sich herausstellen, weil er die Menschen fürchtet, vielleicht, ohne dass ihm das bewusst wird, Unserer Zukunft hängt von denen unter uns, besonders unter den Jungen ab, die diese wunderbare Freiheit finden.

Dr. Ralph Bircher

Inhaltsverzeichnis:

Vorwort vom Prof. Zabel
Zum Geleit
Rezept Dr. Bircher-Benners für einen Patienten im Jahre 1896
Der Start
Die Wunde
Der Maturand
Der Rückschlag
Das Medusenhaupt
Der Zeitgeist und das Unzeitgemässe
Sprung in die Praxis
Die Entdeckung
Der Aufbruch ins Unbekannte
Ziel in Sicht
Lebens-Nahrung
Kalorien täuschen!
Das kostbare „ Etwas“
Die neue Nährwertlehre
Die Versuchung
Ein Vorläufer
Ein neuer Vorstoss
Drei Ziele
Das „ Prophetische“
Das „ Erzieherische“
„Du sammle still und unerschlafft im kleinsten Punkt die grösste Kraft“
Kleiner Zwischenakt
Hintergrund und Wirkung
Bircher-Benners Lehre
Die Ordnungsgesetze des Lebens
1. Das Ordnungsgesetz der Nahrungsenergie
2. Integral-Gesetz der Nahrung
3. Das Ökonomie-Gesetz der Ernährung
4.Das Ordnungsgesetz der Nahrungspforte
5.Das Ordnungsgesetz der Mahlzeitenzahl
6. Das Ordnungsgesetz der Atmung
7. Das Ordnungsgesetz der Beziehung zum Licht
8. Das Ordnungsgesetz der Beziehung zur Temperatur
9. Das Ordnungsgesetz der Beziehung zu Schwerkraft
10. Das Ordnungsgesetz der Beziehung zu den Umweltrhythmen
Vom Wesen der Krankheit und der Gesundheit
Die Brücke zur Therapie
Vom Gesamtheilplan
„Suggestion“ und „ Induktion“
„Ausgespanntheit“
„Was ist aus meinem Lebenswerk geworden?“
Die Grösse der Arzt-Berufung
Danksagung von Prof. Kollath
Stiftungsurkunde

Die Lehren Bircher-Benners auf dem Gebiet der gesundheitsschaffenden Ernährung, der heilenden Lebensordnung und des neuen Arzttums sind in kurzen Zusammenfassungen zusammengestellt und vom heutigen Stand aus besprochen. Erstaunlich, was Bircher-Benner alles als erster erkannt, formuliert und verwirklicht hat, wovon Nachfolgende glauben, es neu zu entdecken! Höhepunkt der Darstellung sind die Kapitel über die Entdeckung des Heilwertes der Rohkost, die er als erster gezielt ausgewertet hat, jener über das “Prophetische“, das Erzieherische“, den Hintergrund“ und die „Ausgespanntheit“. Das Schönste an diesem Lebensbild, besonders für Junge, ist wohl, wie die Furcht vor der Meinung der Menschen überwunden wurde. Die geistige Freiheit, die daraus entstand, ermöglichte eine ungeahnte Entfaltung der Gaben.


Vom Werden des neuen Arztes

Dr. med. Max Bircher-Benner

Vorwort zur Neuauflage 2014

Als Maximilian Bircher-Benner dieses bedeutende Werk niederschrieb, lagen vier Jahrzehnte ärztlichen Schaffens hinter ihm, in denen er das Leiden und die Biographie Zehntausender erfahren und verinnerlicht hatte und sie auf ihrem Weg zur Heilung angeleitet und begleitet hatte. Mit wissenschaftlichem Scharfsinn und einer aussergewöhnlichen Fähigkeit, unabhängig von vorgegebenen Meinungen zu denken, war er stets auf der Suche nach der Wahrheit. Die seltene Gabe, seine Patienten sowohl mit Intuition und Einfühlung, als auch mit genialer intellektueller Klarheit zu erfassen, machten ihn zu einem grossen Arzt und Pionier wissenschaftlich fundierter Naturheilkunde. Unsere moderne Medizin versteht Krankheitssymptome als Feind, den es zu bekämpfen gilt.

Die medizinischen Diagnosen sind in aller Regel ein reiner Symptomenbeschrieb. Von da aus geht der Weg der Weg meist direkt zu den Medikamenten, wenn nicht zur Chirurgie. Genau wie vor 70 Jahren, als Bircher-Benner dieses Buch geschrieben hat, wissen auch heute die Patienten, die zu uns in die Behandlung kommen nicht, warum sie krank geworden sind, denn die gemeinsame Suche nach den Ursachen war noch immer meistens ausgeblieben. Maximilian Bircher-Benner hat schon in jungen Jahren verstanden, dass die Symptome nicht die Krankheit sind, sondern der Ausdruck einer immensen Anstrengung der Lebenskraft, die dazu angetan ist, die vorhandene Störung der Ordnung im biologischen System des erkrankten Menschen zu beseitigen. Damit richtet sich der Blick des Arztes auf das Gesunde im Menschen, auf seine Lebenskraft und das ärztliche Handeln auf die Unterstützung der Heilungskraft. Die globalen Statistiken der WHO belegen seit vielen Jahren eine ständige Zunahme aller chronischen Krankheiten in allen Ländern, wo moderne Medizin betrieben wird. Chronische Krankheit, entsteht da, wo das biologische System den Rückweg aus entstandener Unordnung nicht findet. Symptomunterdrückung richtet sich gegen die Heilungsanstrengung des biologischen Systems und damit gegen die Lebenskraft. Die ständige Zunahme der chronischen Krankheiten belegt eindrücklich, dass ein „ Missverständnis“ besteht, zwischen unserem aktuellen medizinisch Paradigma und der Biologie des Menschen. Bei aller Anerkennung des Genies der medizinischen Technik und der Pharmakologie war unsere moderne Medizin nicht in der Lage, die häufigsten Krankheiten zu verhüten und zu heilen. Vor über 70 Jahren hat dies Maximilian Bircher-Benner bereits erkannt und einen“ Neuen Arzt“, eine neue medizinische Schule gefordert, ein neues wissenschaftliches Paradigma, ein Umdenken, für welches erst heute die Zeit reif geworden ist. So gehört dieses Vermächtnis genauso wie der hippokratische Eid in die Hand jedes werdenden Arztes. Ein faszinierendes Werk für alle Denkenden und Suchenden, die nicht mit allen Entwicklungen unserer modernen Medizin Schritt halten können. Ein lebendiges Buch, das uns gefesselt hält.

Braunwald, den 2. April 2014 Dr.med. Andres Bircher

nhalt
Vorwort zur Neuauflage 2013
Vorwort zur Neuausgabe 1989
Vorwort

1 Einleitung
Anlage- Kindheits-und Jugenderlebnisse als Richtungsimpulse-
Gewöhnung an unablässige, mannigfaltige Arbeit- Berufswahl

2 Das Medizinstudium
Das Wunder des Lebens - Enttäuschung – Abstinenz – Hypnose und Suggestion

3 Die Praxis
Krankheitsnot und Versagen der Therapie – Irrtümer, Unwissenheit und
Ihre Überwindung

4 Die Lösung der Ernährungsfrage
Nährwert-Umwertung-Ungesundheit durch Missernährung-
Ernährungskrankheiten-Heilernährung

5 Ordnungstherapie
6 Psychotherapie

7 Der neue Arzt als Körper- und Seelenarzt

8 Unterschiede in der Heilbehandlung

Max Oskar Bircher-Benner

Ein biographischer Abriss von Dr. Ralph Bircher

Literatur

Dieses Buch dieses genialen Arztes und Pioniers einer wissenschaftlich fundierten Naturheilkunde, der in seiner Klinik tausenden Menschen aus der ganzen Welt zur Heilung ihrer chronischen Leiden verholfen hat, die als unheilbar gegolten hatten, ist hochaktuell. Es zeigt den biographischen Weg vom gut ausgebildeten Mediziner zum“neuen Arzt“ , der in der täglichen Praxis und Therapie seiner Patienten eine ganz neue ganzheitliche Sicht des Menschen, seiner Biologie und seiner Seele erkannt hat, eine geniale Sichtweise, die den Ausweg aus der Sackgasse in der sich unsere moderne Medizin und unser „Gesundheitssystem“ heute befindet, aufzeigt.


Geheimarchiv der Ernährungslehre

Heraus aus dem Labyrinth der Ungesundheit.

Heraus aus dem Labyrinth der Ungesundheit:
Gesundheit- was ist das?- wie erkennt man sie? – wo findet man sie?
Diese Frage ist heute brennend geworden, brennender wohl als je. Denn trotz phänomenaler Fortschritte in Forschung, Medizin, Schulung, und Technik der Krankheitsbekämpfung stehen wir vor allseitiger Klage über einen drohenden Zusammenbruch des „ Gesundheitswesens“, so wie es gemeinhin verstanden wird.

Der gesunde Menschenverstand sagt uns zwar, dass Gesundheit sicherlich zum Allerpositivsten gehört, was man sich denken kann. Fülle und Erfüllung des Lebens. Aber in praxi stehen wir vor einer paradoxen Situation. Nach einer massgebenden Prominenz-Prof. Bauer-ist „Medizin entweder naturwissenschaftlich, oder sie ist nicht“, nach einer anderen-Prof. Rothschuh in seiner „Theorie des Organismus“- ist Gesundheit mit naturwissenschaftlichen Methoden grundsätzlich nicht fassbar, und nach einer dritten-Prof. V.v. Weizsäcker- können wir mit unseren derzeit angewandten Methoden dem Wesen des Lebens und der Gesundheit nicht näher kommen als ein Bergwerk dem Mittelpunkt der Erde.

Es bedarf also vor allem einer Ausweitung der Wissenschaft über die analytisch-messenden und statistischen Methoden der Naturwissenschaft hinaus, eine neue, umfassendere Wissenschaftlichkeit, die aber ähnlich zuverlässige Ergebnisse ermöglichen muss. Sonst bleibt unser „ Gesundheitswesen“ in einer fatalen Sackgasse.
Schon Nietzsche rief nach einer anderen, positiven Gesundheitslehre, und seit drei Generationen suchen namhafte Ärzte, Denker und Erzieher nach einer entsprechenden Ausweitung der Wissenschaft über das rein naturwissenschaftliche, analytisch-messende hinaus und haben auch da und dort neue Methoden mit verlässlichen Ergebnissen erarbeitet. Seit Jahrzehnten auch haben immer wieder höchste Fachgremien die positive und nicht nur als Fehlen krankhafter Störungen verstandene Gesundheit als Ziel der Forschung gefordert und den Ausdruck „sturmfeste Gesundheit“ (buoyant health) geprägt. Eine Anzahl neuartiger Methoden und Ergebnisse sind in angesehensten Fachorganen erschienen. Aber das Zeitbewusstsein hat sie seltsamerweise nicht zur Kenntnis genommen, weder fortgeführt noch widerlegt. Sie passten anscheinend nicht ins Konzept und sind ungeprüft und unwiderlegt jeweils im „ Geheimarchiv der Gesundheitslehre“ verschwunden. Fachbücher und Enzyklopädien ingorieren sie und man stösst immer wieder auf Persönlichkeiten, die daran zwar aufs höchste interessiert sind oder sein müssen, die aber von diesen bahnbrechenden Arbeiten und Ergebnissen nichts, oder so gut wie nichts kennen. Diese Unkenntnis und Verdrängungstendenz hat seit den fünfziger Jahren sogar noch zugenommen.
Nun sind diese Arbeiten und Ergebnisse aber nicht wirklich verloren. Man muss nicht zusammensuchen aus der unübersehbaren Fachliteratur, sondern es gibt ein Organ, das sich seit langer Zeit speziell der Aufgabe gewidmet hat sie laufend weltweit zusammenzusuchen, soweit das immer möglich war, sie kritisch wägend und vergleichend zu sammeln und zu berichten: „ Der Wendepunkt“, stets eingedenk der Mahnung von André Gide: Zweifelt an jenen , die die Wahrheit haben, glaubt jenen, die sie suchen!“ Denn hier, wenn irgendwo, erhebt sich die Frage der Zuständigkeit. Wo es um Gesundheit in diesem Sinne, um Lebensqualität geht, werden ja alle Fachexperten zu Laien, ob es sich um körperliche, seelische, geistige oder soziale Gesundheit handle. Mit dem Anwachsen, der Wissensgebirge ins Ungeheure, Unübersehbare, der Informationsflut ins Unschluckbare, mit der Apparate- und der Wirtschaftsäbhängigkeit der Forschung und der immer grösseren Einenung des Wissens in Spezialistensparten, scheint es kaum mehr möglich geworden zu sein, die Zusammenhänge und Ganzeitsgestalten, die das Leben bietet, zu erfassen. Übrig bleibt nur einerseits höchste Achtung vor allen echten Forscherleistungen und anderseits ein Bekenntnis: Wir sind heute alle Laien, wenn es um Derartiges geht. Qualifizierung verlangt hier, bei grundsätzlicher Bescheidenheit und Offenheit, die Schärfung und Verfeinerung des Sinnes für die Hintergründe aller Informationen, soweit dies menschenmöglich ist, und den Versuch, gegensätzliche Tendenzen in ihrem Wesen und ihren Auswirkungen bis in ihre Extreme zu verfolgen und durchzudenken, um durch die dadurch gewonnene Weitung des Blickfeldes die fruchtbaren Ansatzpunkte und Suchrichtungen zu finden.

Nehmen wir als Beispiel die Zusammenhänge Ernährung und Gesundheit. Naturwissenschaftlich analytische und statistische Methoden bis hin zu Blindversuchen und zur Anwendung modernster Apparaturen und Methoden sind zweifellos von hohem Wert. Wichtiger aber noch ist, was vorausgeht: die Fragestellung, und das, was folgt, die Auswertung. Beides entzieht sich aber völlig der naturwissenschaftlichen Methodik. Fruchtbarste Fragestellungen ergeben sich zum Beispiel aus der Geographie und Geschichte der Ernährung; aber diese Gebiet ist der Fachwelt so gut wie unbekannt. Einschlägige Werke und Veröffentlichungen wertvoller Untersuchungen sind zwar in nicht geringer Zahl vorhanden, aber weder genügend kritisch gesichtet noch verwertet worden. Es gilt, sie aus dem „Geheimarchiv“ zu ziehen und weiterem Forschen zugrunde zu legen. Und sowohl bei der Fragestellungen wie bei den Auswertungen spielt auch die wirtschaftliche Lage eine oft entscheidende Rolle, die es zu erkennen zu beachten gilt. Um sich davon Rechenschaft zu geben, braucht man nur die Fachliteratur der Not-Und Rationierungszeiten und jene der Überflusszeiten zu vergleichen. Insbesondere aber ist zu bedenken, dass nicht nur grösste naturwissenschaftliche Genauigkeit, sondern auch kritische Fragestellung und kluge Auswertung erst dann ihren vollen Wert gewinnen können, wenn zuvor der Begriff „Gesundheit“ geklärt ist, insofern die echte, die positive, die sturmfeste Gesundheit in ihrem Wesen und ihren Entstehungsmöglichkeiten erkannt worden ist.

In diesem Sinne ist, wie erwähnt, im „ Wendepunkt“ alle fortlaufend auf den Fachliteraturen gesammelt und kritisch sichtend zu berichten gesucht worden, insbesondere seit Mitte der dreissiger Jahre, als das Interesse dafür angesichts der Wirtschaftslage in der Fachwelt einem Höhepunkt entgegenging, aber auch in allen folgenden Jahrzehnten und insbesondere seit der neuen Wendung im Zeitgeist der letzten 10-20 Jahre. Ich widmete alle verfügbare Zeit dieser Aufgabe in Verbindung mit Ärzten und Fachleuten verschiedener Gebiete. Da die Ergebnisse dieser Arbeit aber in vielen Jahrgängen enthalten und somit nicht leicht zugänglich und auffindbar sind, werden sie hier, soweit von zeitloser Bedeutung und von Zukunftswert, in einer Reihe handlicher kleiner Bände geordnet zur Verfügung gestellt.

Dr. Ralph Bircher

Inhaltsverzeichnis:

  • Vorbemerkung
  • „Der Arzt ist nun im Begriff“
  • „Es gibt keine Alterskrankheiten“
  • „Verschafft uns eine Ernährungswissenschaft!“
  • „Ursachen unbekannt“
  • Der Grosse Fastenmarsch
  • „Wandelnde Leguminosen“
  • „Eine Gute Speise, Fast wie Fleisch“
  • Wieviel Nahrung braucht der Mensch?
  • Die Rohkostforschungen von Eppinger und Kaunitz
  • Längst Fällige Neuprüfung der Naturheilkunde
  • Die Verdauungs-Leukozytose
  • Die Tarahumara
  • Vollgesundheit bei „ Hungerkost“
  • Grösste Lebensleistung mit geringster Nahrungsmenge
  • Knappe Kost-Langes Leben
  • Grösster Milchertrag bei Knappster Fütterung!
  • Prof. Eimers Rohkost-Sportstudenten
  • Hindhede
  • Das Chittenden-Experiment
  • Die Ergebnisse von Osaka
  • Goms
  • Vorkriegs-China
  • Die Bantu-Untersuchung
  • Die Java-Untersuchungen
  • Mexiko-„Dreierlei Hunger“
  • Wie die Wikinger sich Ernährten
  • Eskimoernährung und- Gesundheit
  • Jersey
  • Portonico
  • Der Eiweissminimum-Versuch Rhyn-Abelin
  • Sachregister

Zu wenig bekannte Belege, die jeder kennen sollte, dem es um die Gesundheit geht.

Ein hilfreiche, sonst nirgends zu findende, Fülle von zu wenig bekannten Forschungsergebnissen und prominenten Erklärungen zur Frage, wie sturmfest Gesundheit und Aufschwung der Selbstheilkräfte zu gewinnen sind, knapp, klar und verständlich vorgebracht und rasch nachschlagbar.


Zwischen Birchermüesli und Lebensphilosophie

Von Dagmar Liechti-von Brasch

Im März 2004 findet im Zürich Development Center am Zürichberg ein dreitägiges Symposium aus Anlass der 100-Jahre-Feier der Bircher-Benner-Klinik statt. Wo sich jetzt in dem topmodern umgebauten riesigen Komplex an privilegierter Lage hoch über dem Zürichsee mit Blick auf die Alpen Manager zu Seminarien treffen, liessen sich einst Patientinnen und Patienten aus der ganzen Welt im Sanatorium „Lebendige Kraft“ mit der revolutionären Ordnungstherapie von Max Bircher-Benner behandeln. Die Klinik holte viele berühmte und bekannte Menschen nach Zürich, Thomas Mann
beispielsweise beschreibt in seinem Tagebuch die „hygienische Zuchtanstalt“ mit Augenzwinkern, auch Erika und Klaus Mann suchten die Bircher-Benner-Klinik auf. Zu Zeiten Max Bircher-Benners war Hermann Hesse ebenso Patient der Klinik wie später der englische Schatzkanzler Sir Stafford Cripps und der tunesische Präsident Habib Bourguiba, als Bircher-Benners Nachfolgerin Dagmar Liechti-von Brasch das Sanatorium leitete.

Hundert Jahre nach der Gründung der Klinik befasst sich ein hochkarätig besetztes wissenschaftliches Symposium, moderiert von Dr. Eberhard Wolff, dem Leiter des Bircher-Benner-Archivs, seiner Ernährungslehre, deren Auswirkungen und seinem Beitrag zur Entwicklung der alternativen Medizin. Der Name des Klinikgründers, Pioniers, Ernährungsrevolutionärs, des Familien- und Firmenpatriarchen-zu Recht als einer der grössten Zürcher Ärzte und Menschenfreunde gewürdigt- ist allgegenwärtig. Hingegen erwähnt nur gerade die Schauspielerin Maria Becker, die anschaulich ihre Erfahrung und ihre Genesung in der Klinik schildert, Bircher-Benners Nichte Dagmar Liechti-von Brasch, als  Chefärztin von 1947 bis 1980 das Erbe des Onkels erfolgreich weitergeführt hat. Ohne sie, das lässt sich aus der Rückschau sagen, wäre vermutlich in der zweiten Hälfte der 1940er-Jahre das End4e der stolzen Tradition der Klinik besiegelt gewesen. Was die „begnadete Ärztin“ geleistet hat- auch wenn sie nur“ Birchers medizin-therapeutisch Errungenschaften umgesetzt und erweitert hat-ist aussergewöhnlich, typisch und untypisch zugleich für eine Frau in einer Zeit, wo weibliche Berufstätigkeit als die unvermeidbare Ausnahme angesehen wurde, Zwar stand sie selten am Herd, doch war Dr.med. Liechti-von Brasch nicht nur eine herausragende Ärztin und Leiterin einer grossen, renommierten Privatklinik mit internationaler Ausstrahlung, sie war auch Ehefrau und Mutter von vier Kindern.

Das die Feier von hundert Jahren Bircher-Benner-Klinik ohne die Würdigung der langjährigen Chefärztin über die Bühne ging, blieb nicht ohne Folgen. Die drei Töchter übernahmen die Initiative, das Wirken von Liechti-von Brasch aufzuarbeiten. Die Vorliegende Biografie ist das Ergebnis davon.

Dagmar Liechti-von Brasch begann ihrerseits Ende der 1980er Jahre mit autobiografischen Aufzeichnungen auf Tonband und führte diese in Form von Gesprächen zu Beginn der 1990er-Jahre mit der finnischen Schriftstellerin Kirstin Manninen- sie ist die Schwester von Matti Aukia , dem Mann von Liechtis jüngster Tochter Ruth- fort. Die Essenz ihrer persönlichen, beruflichen, wie auch spirituellen Erfahrungen finden sich, ganzheitlich verwoben, in ihren Memoiren, die mehrere hundert Seiten Gesprächstranskription umfassen. Mit Kirsti Manninnen erarbeitete Dagmar Liechti-von Brasch bis kurz von ihrem Tod die ersten beiden Kapitel ihrer Autobiografie. Nach deren Durchsicht  schrieb sie am 20. Oktober 1992 an die finnische Freundin: „Zu unserem Buch: Ich habe ein Stück- so aus Distanz- gelesen und als persönliches Dokument wieder miterlebt. Da wurde mir aber klar, dass es nicht nur Einzelschicksal, sondern Zeitbild mit historischem Hintergrund sein muss. Es braucht einen Rahmen, dh. Recherchen-mit der Entwicklung der Klinik, der Geschichte, der Politik. Es braucht Interviews mit Patienten&Mitarbeitern, Politikern jener Zeit usw. Nur so hat das Buch und mein persönliches Leben einen soliden Hintergrund.“
Der Wunsch von Dagmar Liechti-von Brasch begleitete uns bei unserer Arbeit: Ihre Biografie soll auch ein „Zeitbild“ sein. Wir haben das Material ihre Lebenserinnerungen, bearbeitet, rund um die Klinik recherchiert, mit ehemaligen Mitarbeiterinnen gesprochen, Ärztinnen der Klinik, Krankenschwestern Patientinnen, Patienten und Freundinnen, die drei Töchter und eine  der Enkelinnen von Dagmar Liechti-von Brasch interviewt. Abgesehen von den autobiografischen Aufzeichnungen fehlt ein Nachlas weitgehend. Nur Foto und einzelne mehr zufällig erhalten gebliebene Dokumente, wie zum Beispiel Tagebücher von Ihren Reisen, standen uns zur Verfügung. So sahen wir uns auch mit grossen Lücken konfrontiert. Das Bircher-Benner Archiv in Zürich ist auf Max Bircher-Benner und dessen Familie ausgerichtet und beschränkt sich auf Patientendossiers. Weiteres Material aus der Bircher-Benner-Klinik befindet sich in Privatbesitz und ist nicht erschlossen. Bis anhin fehlen eine historische Untersuchung über das Wirken von Ärztinnen in der Schweiz und über die Bircher-Benner-Klinik

Aufgrund des Materials haben wir die Biografie in zwei Teile gegliedert. In einem ersten Teil, mehrheitlich von Kathrin Barbara Zatti verfasst, zeichnet sie unter dem Titel „Werdegang“ Kindheit, Jugend und Ausbildung von Dagmar Liechti-von Brasch nach. Diese Ausführungen basieren hauptsächlich auf dem autobiografischen Material, ergänzt durch die wenigen Dokumente, die erhalten geblieben sind. Eine wertvolle Quelle sind die vielen Fotos aus jener Zeit, die auf einer anderen Ebene einen Zugang zu Dagmar Liechti-von Brasch ermöglichen. Zitate aus den autobiografischen Aufzeichnungen sind im Haupttext in Anführung gesetzt, auf den Nachweis in den Anmerkungen haben wir hingegen verzichtet. Wenn andere Quellen verwendet wurden, sind diese in den Anmerkungen nachgewiesen. Unterstrichene Begriffe und Namen verweisen auf zusätzliche Informationen im Anhang. Ihre Arbeit als Ärztin und Chefärztin der Klinik 1939-1980, die Lebensphase als Ehefrau und Mutter, das Frauenbild, von dem sie sich leiten liess, die Jahre nach ihrem endgültigen Rücktritt werden im zweiten Teil geschildert. Dagmar Liechti-von Brasch sieht sich in erster Linie als Nachfolgerin von Max Bircher-Benner. In ihrer Arbeit, die sie ganz in den Dienst der Patientinnen und Patienten stellt, nimmt sie sich als Person zurück. Die autobiografischen Texte, die sich auf diese Zeit beziehen, schildern immer weniger ihre persönliche Entwicklung und stellen zunehmend ihre medizinischen Erfahrungen und Überzeugungen dar. Für den zweiten Teil, Hauptsächlich von Marina Widmer geschrieben, stützen wir uns deshalb neben den autobiografischen Tonbandaufzeichnungen auf Recherchen in Archiven und, um die Geschichte der Klinik aufzuarbeiten, auf Gespräche mit ehemaligen Krankenschwestern, Angestellten und Ärztinnen der Klinik sowie auf Gespräche mit ihren Töchtern und einem Schwiegersohn.

Marina Widmer, Kathrin Barbara Zatti Sommer 2008

Inhaltsverzeichnis:

Vorwort
Werdegang 1911–1939
Schwarzhof
Erinnerungen an die Mutter
Der gefleckte Panther

Onkelpapa Max

Entscheidung
Aussenseiterin
Der kleine Revolver
Ansporn und Bedrohung
Lehrzeit in London
Tod von Onkel Max

Das Erbe 1939–1993

Ins kalte Wasser geworfen
Nach dem Krieg
Die «Bircher-Frauen»
Dem Patienten dienen
Die Publizistin
Der Klinikalltag
Das Familienleben der Chefärztin, Mutter und Ehefrau
Gedanken über Geschlechterrollen
Offen für andere Therapieansätze
Reisen nach Indien
Der langsame Niedergang der Bircher-Benner-Klinik 1973–1994
Die Jahre nach dem Rücktritt
Die letzten Lebensjahre
Anhang

Dagmar Liechti-von Brasch, geboren 1911 in Estland, kommt nach dem frühe Tod der Mutter mit ihren Geschwistern nach Zürich, wo sie in der Familie ihres Onkels Max Bircher-Benner ein neues Zuhause findet. Sie studiert Medizin und wird Assistenzärztin in der Klinik des Onkels, dem Erfinder des 'Birchermus', auch Apfeldiätspeise genannt. Nach seinem Tod 1939 übernimmt Dagmar Liechti-von Brasch, mittlerweile Mutter von vier Kindern, vorübergehend die Leitung der Klinik, ab 1949 wird ihr diese Aufgabe ganz übergeben. Es gelingt ihr, der Klinik zu neuem Aufschwung zu verhelfen und den ganzheitlichen Ansatz weiterzuentwickeln. Marina Widmer und Kathrin Barbara Zatti zeichnen Leben und Wirken der Ärztin Dagmar Liechti-von Brasch nach. Deren Schwierigkeiten, Beruf und Familie gerecht zu werden, klingen nur allzu vertraut und aktuell. Dass es ihr trotzdem gelungen ist, medizinische Pionierarbeit zu leisten, ist nicht nur im historischen Kontext bewundernswert.

Autoren:
Marina Widmer, geboren 1956, Soziologin. Geschäftsleitung des Archivs für Frauen- Geschlechter- und Sozialgeschichte Ostschweiz. Mitherausgeberin von «Blütenweiss bis rabenschwarz. St. Galler Frauen. 200 Porträts» (Limmat Verlag) und der Monografie zu Elisabeth Gerter, «Nicht die Welt, die ich gemeint». Lebt und arbeitet in St. Gallen.

Kathrin Barbara Zatti, geboren 1958, Historikerin, Sozialtherapeutin. Mitautorin der Biografie von Elisabeth Pletscher, «Es gibt Dinge, die brauchen Zeit». Lebt und arbeitet seit 2005 als Autorin, Fotografin und Fachfrau für Traumatransformation in Trogen.